SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|SAKL0C04422g from Lachancea kluyveri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|SAKL0C04422g
Domain Number 1 Region: 1583-1883
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-120
Family BEACH domain 0.0000000426
Further Details:      
 
Domain Number 2 Region: 1392-1444,1492-1543
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-17
Family PreBEACH PH-like domain 0.031
Further Details:      
 
Domain Number 3 Region: 1979-2215
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000145
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 218-354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000678
Family Laminin G-like module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|SAKL0C04422g
Sequence length 2216
Comment similar to uniprot|P25356 Saccharomyces cerevisiae YCR032W BPH1 [Saccharomyces kluyveri] Complete CDS. SAKL0C04422g
Sequence
MPDDARKLVNLLSQILDMHAGMGDGPVGSSPQTQTQTQTQLMEILANYQADRESITDSNA
SASASASASASAELADYVEFEIAQRFVNLDDTEDNFNTEDADLWKQFLSLTCQQPHPLYA
VAVQLVVSLANNSLVNKQKLAAVPDLKPLLLERLQSAQGSPLLLNVLAELYCLLLFTNCR
PRDLLAVYAECKRRCPVHFRVLNALAAQLSDPYSQSFLQFENAYRLFRTDSPRDQYTLQL
WIELNNTTSNRILTVGNDIFLEVKEAKLCIANDEYILALFDGFEFDTNTMYQLTLAVDGD
DIALYVDGGLVQHISLVQGSIKRIRRLELGSMICSFKLYKFMMWSELLYEASVRLLCEVG
LLHQRACDQSPNAHDILSMFGDHLLQKVYAAMDTPGMTYGLCAQQVRQLKSENLVEIVDP
RRVISTNRVDPVACTLRWDNGEGNGEGNGEGTDNDVSIGKVYYYQAANVVSCFAATDSFS
IVLALLDDSADLQQAYTCVEHLLLLLKHPGLKSEFEKSFGYPLLAHVLAWDVLRRLQQPL
SVDFLNLFLEFCGWDIADPSRSILASESAYTSLILNLELWLPREHGDSRRAASLEIVRFL
FFQLGELVQTSRNRLYNSKKLQRLGVIQRLTQHQHVAYNKNKTDNPFDELSAALAGVYKT
LLLEELSHNTTTYLLHFAYYEMRCGYHRSSETALEAVDAAFLDTIQSQKLDAVTTVSRSM
SLKLLLMNLDCGTEPGTIPTLVLGMLFKYLQVNPEYYGGFVKNNGYALLFSIFKTFRLQT
YRSLVLLLHTYSVNECVSHGSLPATFAPAPGCGAADTRISMVENHYLIIDMLEWAVMNDI
TENMQADLDALIESYACALLRMQDGMPRQDAFDPRRSRLVERLTELLLTLRKPQNGTLYE
AAAGSVALLVAGNVLLHLKTLKSSDFAEYMDALVEIHAGHESLSGMPVATKAINYIRPAV
WLHIFPEVVRRLVDTAPMFATVFAQHEHMFGNLCFLLQRYKETLYAFQWDTGCYVAVHKC
IAAAAETVFNSPHPHVRASMKSSILQTESFALAAMFYLVLLQERGFDDATARVFFESLLF
HQETLFGTQQKHQFFDKEFCSYILLFLARYAQSGAGGSGPRALALNCFRTIVLHRSESLR
DIATIISRQEGDCVFQLLAKCMCSDDEELYGLLTSREARLYFGAHLAVFEKRYVQKNFAQ
WCQGELVPAAQVLDNVLELKQAGMERRYSGMLSMYQLLKKDNLAFDQKIVTAVEKKLLYF
LNDMEDDLLLYTEAVHRLKTALARRMGIQEGCKDRPTWALESIEDYNRMRKRLVPKHEAL
CCSYGEVFGADRELQPELQPELSPSSVARDRRASSSIMSFEVINDFQSFEISKIETEDKN
SKVLRSLRQGDSIKSIWNSSHVVGLTINEGILIMGVKNLYFINNYFFSSDNKHVIELQDA
PEYERDTNIKLISGSVGVSASVSAGTNGTSGFGDAGVGGGGADSIKANSHEVQVWELDKL
GSTTKRPFLLRDVALELVFEDGKNCFFSFSSVALRDVVYQQISRVPKNTDIDPVLLDVLS
EINIRSTDIGIKNGIAQSTLSSRFSSVFSNAPDLTRSFDFLKKWQNGEISNFYYLMIVNT
LAGRTFNDLTQYPVFPWVIADYASADLDLDDPKTYRDLSRPMGAQSEKRRRQFVERYEAL
ASLGDAEAPPFHYGTHYSSAMIVSSYLIRLEPFVGSYLILQGGKFGHADRLFNSIERAWL
SASAESTTDVRELTPEFFFLPDFLQNVNGYDFGALQSGARVDDVVLPPWAKGDPKIFVAK
NREALESRYVSENLHKWIDLVFGCKQKGSAAVEAVNVFNRLSYPGAVDLERIDDENERRA
VTGIIHNFGQTPLQLFESPHPSRKDPGVYQVNGSSWDYLPRSPCVSSVCNSTVTSAEASG
RGDAGPGVKHLEFETVAHGVPMWRGYRTWCLSLDSQSRGLAVRKVSPCSVEVRDKTFEAV
HSDEISALAVHKRGQFVSGDKSGLLKLWRCSSTVDDVAIEGLSCFYGHLCEIQEIHTTGE
YNTMVTLDSSGIVYSWDVLEAEIIRQFSSTAKHAAVSNATGNVAVVERDNRLSVYDLNGS
LYGSKTFAQDITCVSFGDMNSVERGFKRHVYWKEKDIVGVGLANGEVCVLELKLSSGGGW
ELVHLKTVATGTPSAVSCLSVQMRIVPLDNGSKFPVNIAKCEIVAGDCSGGVYVWR
Download sequence
Identical sequences gnl|GLV|SAKL0C04422g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]