SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376289582|ref|YP_005161829.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376289582|ref|YP_005161829.1|
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.4e-29
Family Ribosomal L11/L12e N-terminal domain 0.000091
Further Details:      
 
Domain Number 2 Region: 69-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.22e-27
Family Ribosomal protein L11, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376289582|ref|YP_005161829.1|
Sequence length 142
Comment 50S ribosomal protein L11 [Corynebacterium diphtheriae C7 (beta)]
Sequence
MAPKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEI
TVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGSVTMDQVKEIAQTKMEDLNA
NDIENAARIIAGTARSMGIEVK
Download sequence
Identical sequences A0A0D6FG19 P60101
gi|376247709|ref|YP_005139653.1| gi|375292320|ref|YP_005126859.1| WP_004566658.1.100106 WP_004566658.1.100437 WP_004566658.1.10059 WP_004566658.1.101620 WP_004566658.1.11186 WP_004566658.1.12056 WP_004566658.1.12077 WP_004566658.1.12285 WP_004566658.1.12321 WP_004566658.1.12973 WP_004566658.1.13923 WP_004566658.1.14626 WP_004566658.1.14799 WP_004566658.1.14870 WP_004566658.1.15382 WP_004566658.1.16169 WP_004566658.1.16198 WP_004566658.1.16616 WP_004566658.1.16923 WP_004566658.1.17258 WP_004566658.1.18214 WP_004566658.1.1865 WP_004566658.1.18730 WP_004566658.1.19402 WP_004566658.1.20047 WP_004566658.1.20592 WP_004566658.1.21235 WP_004566658.1.21530 WP_004566658.1.21794 WP_004566658.1.22463 WP_004566658.1.22617 WP_004566658.1.22666 WP_004566658.1.2359 WP_004566658.1.24021 WP_004566658.1.24410 WP_004566658.1.24452 WP_004566658.1.24530 WP_004566658.1.25161 WP_004566658.1.26586 WP_004566658.1.26788 WP_004566658.1.27503 WP_004566658.1.27633 WP_004566658.1.2787 WP_004566658.1.28984 WP_004566658.1.29044 WP_004566658.1.29777 WP_004566658.1.31012 WP_004566658.1.31738 WP_004566658.1.32250 WP_004566658.1.32370 WP_004566658.1.33126 WP_004566658.1.33228 WP_004566658.1.33434 WP_004566658.1.33864 WP_004566658.1.33967 WP_004566658.1.34071 WP_004566658.1.34190 WP_004566658.1.34866 WP_004566658.1.35091 WP_004566658.1.35564 WP_004566658.1.35664 WP_004566658.1.35693 WP_004566658.1.35790 WP_004566658.1.36295 WP_004566658.1.36771 WP_004566658.1.37348 WP_004566658.1.37559 WP_004566658.1.38550 WP_004566658.1.39266 WP_004566658.1.39547 WP_004566658.1.40217 WP_004566658.1.40713 WP_004566658.1.41054 WP_004566658.1.41076 WP_004566658.1.41144 WP_004566658.1.42068 WP_004566658.1.42841 WP_004566658.1.43515 WP_004566658.1.43592 WP_004566658.1.43747 WP_004566658.1.4375 WP_004566658.1.44089 WP_004566658.1.44404 WP_004566658.1.4460 WP_004566658.1.4494 WP_004566658.1.45217 WP_004566658.1.45526 WP_004566658.1.47154 WP_004566658.1.47392 WP_004566658.1.48478 WP_004566658.1.49767 WP_004566658.1.4993 WP_004566658.1.50438 WP_004566658.1.50680 WP_004566658.1.50903 WP_004566658.1.51796 WP_004566658.1.52698 WP_004566658.1.52799 WP_004566658.1.52812 WP_004566658.1.52928 WP_004566658.1.53607 WP_004566658.1.5502 WP_004566658.1.55063 WP_004566658.1.55162 WP_004566658.1.56350 WP_004566658.1.5645 WP_004566658.1.56495 WP_004566658.1.56555 WP_004566658.1.56727 WP_004566658.1.56741 WP_004566658.1.56858 WP_004566658.1.5692 WP_004566658.1.57575 WP_004566658.1.57683 WP_004566658.1.57961 WP_004566658.1.580 WP_004566658.1.58917 WP_004566658.1.60254 WP_004566658.1.60610 WP_004566658.1.60808 WP_004566658.1.63172 WP_004566658.1.63803 WP_004566658.1.63997 WP_004566658.1.64345 WP_004566658.1.65864 WP_004566658.1.67038 WP_004566658.1.67199 WP_004566658.1.67410 WP_004566658.1.67504 WP_004566658.1.67527 WP_004566658.1.68611 WP_004566658.1.69403 WP_004566658.1.69457 WP_004566658.1.70128 WP_004566658.1.70439 WP_004566658.1.70634 WP_004566658.1.71214 WP_004566658.1.71515 WP_004566658.1.72870 WP_004566658.1.73040 WP_004566658.1.73245 WP_004566658.1.73495 WP_004566658.1.73879 WP_004566658.1.73977 WP_004566658.1.74211 WP_004566658.1.74589 WP_004566658.1.7622 WP_004566658.1.76681 WP_004566658.1.77064 WP_004566658.1.79950 WP_004566658.1.80154 WP_004566658.1.80770 WP_004566658.1.81 WP_004566658.1.816 WP_004566658.1.81989 WP_004566658.1.81997 WP_004566658.1.82314 WP_004566658.1.82318 WP_004566658.1.8291 WP_004566658.1.83056 WP_004566658.1.83106 WP_004566658.1.83112 WP_004566658.1.83614 WP_004566658.1.83857 WP_004566658.1.8401 WP_004566658.1.84071 WP_004566658.1.85108 WP_004566658.1.85489 WP_004566658.1.85853 WP_004566658.1.85905 WP_004566658.1.86054 WP_004566658.1.86272 WP_004566658.1.86739 WP_004566658.1.87428 WP_004566658.1.88098 WP_004566658.1.91366 WP_004566658.1.91773 WP_004566658.1.92257 WP_004566658.1.92337 WP_004566658.1.93248 WP_004566658.1.93436 WP_004566658.1.93774 WP_004566658.1.94018 WP_004566658.1.94633 WP_004566658.1.95829 WP_004566658.1.95894 WP_004566658.1.96122 WP_004566658.1.96168 WP_004566658.1.96386 WP_004566658.1.97137 WP_004566658.1.97188 WP_004566658.1.97735 WP_004566658.1.98240 WP_004566658.1.98565 WP_004566658.1.99854 gi|375290099|ref|YP_005124639.1| gi|376286896|ref|YP_005159462.1| gi|376253538|ref|YP_005141997.1| gi|376289582|ref|YP_005161829.1| 257309.DIP0432 gi|38233046|ref|NP_938813.1| gi|376292494|ref|YP_005164168.1| gi|376250528|ref|YP_005137409.1| gi|376244934|ref|YP_005135173.1| gi|376256343|ref|YP_005144234.1| gi|376242079|ref|YP_005132931.1| gi|376283934|ref|YP_005157144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]