SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376290054|ref|YP_005162301.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376290054|ref|YP_005162301.1|
Domain Number 1 Region: 7-174
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.86e-26
Family N-acetyl transferase, NAT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376290054|ref|YP_005162301.1|
Sequence length 188
Comment putative phosphinothricin N-acetyltransferase [Corynebacterium diphtheriae C7 (beta)]
Sequence
MNAPSQPDFVIRPLRRTDFGQVQQIYLLGLETGHASYEIEAPSWEKFSTSKIPETLFVAV
EKTDDSKVLGWVSAAPISSRTVFRGVVEDSIYIHPDARGRGVAGALVDKLIDVCQHLGFW
AIHSWIFPENEGSARLHASRGFEKVGTFSHLAKMTYGEMAGQWRDTDIWEKLLPKPELAD
HEAAAVEP
Download sequence
Identical sequences A0A0D6FTV5 Q6NI44
gi|376242530|ref|YP_005133382.1| gi|376248216|ref|YP_005140160.1| gi|375290570|ref|YP_005125110.1| gi|376256826|ref|YP_005144717.1| gi|376245403|ref|YP_005135642.1| APC82605 gi|375292783|ref|YP_005127322.1| gi|38233531|ref|NP_939298.1| gi|376251007|ref|YP_005137888.1| WP_003850857.1.100106 WP_003850857.1.100437 WP_003850857.1.10059 WP_003850857.1.101620 WP_003850857.1.11186 WP_003850857.1.12056 WP_003850857.1.12077 WP_003850857.1.12285 WP_003850857.1.12321 WP_003850857.1.12973 WP_003850857.1.13923 WP_003850857.1.14626 WP_003850857.1.14799 WP_003850857.1.14870 WP_003850857.1.15382 WP_003850857.1.16169 WP_003850857.1.16198 WP_003850857.1.16616 WP_003850857.1.16923 WP_003850857.1.17258 WP_003850857.1.18214 WP_003850857.1.1865 WP_003850857.1.18730 WP_003850857.1.19402 WP_003850857.1.20047 WP_003850857.1.20592 WP_003850857.1.21235 WP_003850857.1.21530 WP_003850857.1.21794 WP_003850857.1.22463 WP_003850857.1.22617 WP_003850857.1.22666 WP_003850857.1.2359 WP_003850857.1.24021 WP_003850857.1.24410 WP_003850857.1.24452 WP_003850857.1.24530 WP_003850857.1.25161 WP_003850857.1.26586 WP_003850857.1.26788 WP_003850857.1.27503 WP_003850857.1.27633 WP_003850857.1.2787 WP_003850857.1.28984 WP_003850857.1.29044 WP_003850857.1.29777 WP_003850857.1.31012 WP_003850857.1.31738 WP_003850857.1.32250 WP_003850857.1.32370 WP_003850857.1.33228 WP_003850857.1.33434 WP_003850857.1.33864 WP_003850857.1.33967 WP_003850857.1.34071 WP_003850857.1.34190 WP_003850857.1.34866 WP_003850857.1.35091 WP_003850857.1.35564 WP_003850857.1.35664 WP_003850857.1.35693 WP_003850857.1.35790 WP_003850857.1.36295 WP_003850857.1.36771 WP_003850857.1.37348 WP_003850857.1.37559 WP_003850857.1.38550 WP_003850857.1.39266 WP_003850857.1.39547 WP_003850857.1.40217 WP_003850857.1.40713 WP_003850857.1.41054 WP_003850857.1.41076 WP_003850857.1.41144 WP_003850857.1.42068 WP_003850857.1.42841 WP_003850857.1.43515 WP_003850857.1.43592 WP_003850857.1.43747 WP_003850857.1.4375 WP_003850857.1.44089 WP_003850857.1.44404 WP_003850857.1.4460 WP_003850857.1.4494 WP_003850857.1.45217 WP_003850857.1.45526 WP_003850857.1.47154 WP_003850857.1.47392 WP_003850857.1.48478 WP_003850857.1.49767 WP_003850857.1.4993 WP_003850857.1.50438 WP_003850857.1.50680 WP_003850857.1.50903 WP_003850857.1.51796 WP_003850857.1.52698 WP_003850857.1.52799 WP_003850857.1.52812 WP_003850857.1.52928 WP_003850857.1.53607 WP_003850857.1.5502 WP_003850857.1.55063 WP_003850857.1.55162 WP_003850857.1.56350 WP_003850857.1.5645 WP_003850857.1.56495 WP_003850857.1.56555 WP_003850857.1.56727 WP_003850857.1.56741 WP_003850857.1.56858 WP_003850857.1.5692 WP_003850857.1.57575 WP_003850857.1.57961 WP_003850857.1.580 WP_003850857.1.58917 WP_003850857.1.60254 WP_003850857.1.60610 WP_003850857.1.60808 WP_003850857.1.63172 WP_003850857.1.63803 WP_003850857.1.63997 WP_003850857.1.64345 WP_003850857.1.65864 WP_003850857.1.67038 WP_003850857.1.67199 WP_003850857.1.67410 WP_003850857.1.67504 WP_003850857.1.68611 WP_003850857.1.69403 WP_003850857.1.69457 WP_003850857.1.70439 WP_003850857.1.70634 WP_003850857.1.71214 WP_003850857.1.71515 WP_003850857.1.72870 WP_003850857.1.73040 WP_003850857.1.73245 WP_003850857.1.73495 WP_003850857.1.73879 WP_003850857.1.73977 WP_003850857.1.74211 WP_003850857.1.74589 WP_003850857.1.7622 WP_003850857.1.76681 WP_003850857.1.77064 WP_003850857.1.79950 WP_003850857.1.80154 WP_003850857.1.80770 WP_003850857.1.81 WP_003850857.1.816 WP_003850857.1.81989 WP_003850857.1.81997 WP_003850857.1.82314 WP_003850857.1.82318 WP_003850857.1.8291 WP_003850857.1.83056 WP_003850857.1.83106 WP_003850857.1.83112 WP_003850857.1.83614 WP_003850857.1.83857 WP_003850857.1.8401 WP_003850857.1.84071 WP_003850857.1.85108 WP_003850857.1.85489 WP_003850857.1.85853 WP_003850857.1.85905 WP_003850857.1.86054 WP_003850857.1.86272 WP_003850857.1.86739 WP_003850857.1.87428 WP_003850857.1.88098 WP_003850857.1.91366 WP_003850857.1.91773 WP_003850857.1.92257 WP_003850857.1.92337 WP_003850857.1.93248 WP_003850857.1.93436 WP_003850857.1.93774 WP_003850857.1.94018 WP_003850857.1.94633 WP_003850857.1.95829 WP_003850857.1.95894 WP_003850857.1.96122 WP_003850857.1.96168 WP_003850857.1.96386 WP_003850857.1.97137 WP_003850857.1.97188 WP_003850857.1.97735 WP_003850857.1.98240 WP_003850857.1.98565 WP_003850857.1.99854 gi|376284434|ref|YP_005157644.1| gi|376290054|ref|YP_005162301.1| 257309.DIP0935 gi|376254003|ref|YP_005142462.1| gi|376292951|ref|YP_005164625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]