SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376290117|ref|YP_005162364.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376290117|ref|YP_005162364.1|
Domain Number 1 Region: 97-185
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000138
Family N-acetyl transferase, NAT 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376290117|ref|YP_005162364.1|
Sequence length 226
Comment putative secreted protein [Corynebacterium diphtheriae C7 (beta)]
Sequence
MKRGHVTQTLLLGTVAAVGLGGAACAEFEPETPKNFDQTKVVSIVIDPDDWTQAVLGEAY
KQALTKDAGRLAVVHVRVGEKDSADSASMLSTGRADLYISCTGRELKAHDAKAAAELSKE
YTTDEDRFGSNRGQWRDRTYKELMARLGNRVDATDPSNAMACKQDQEFLPQNIVPLYRMP
VFNRSELATLNHVTARLAQIDFDELVSYAQSHGSAATAVNDKLFDE
Download sequence
Identical sequences A0A1X4MH48
WP_014318909.1.10059 WP_014318909.1.12077 WP_014318909.1.12285 WP_014318909.1.16923 WP_014318909.1.1865 WP_014318909.1.19402 WP_014318909.1.21794 WP_014318909.1.27503 WP_014318909.1.28984 WP_014318909.1.29777 WP_014318909.1.32250 WP_014318909.1.32370 WP_014318909.1.33126 WP_014318909.1.33228 WP_014318909.1.34866 WP_014318909.1.36295 WP_014318909.1.36771 WP_014318909.1.39266 WP_014318909.1.40217 WP_014318909.1.40713 WP_014318909.1.41054 WP_014318909.1.42068 WP_014318909.1.43747 WP_014318909.1.47392 WP_014318909.1.49767 WP_014318909.1.52698 WP_014318909.1.53607 WP_014318909.1.55063 WP_014318909.1.56350 WP_014318909.1.56495 WP_014318909.1.56858 WP_014318909.1.57683 WP_014318909.1.60610 WP_014318909.1.60808 WP_014318909.1.64345 WP_014318909.1.67038 WP_014318909.1.67410 WP_014318909.1.69457 WP_014318909.1.72870 WP_014318909.1.76681 WP_014318909.1.79950 WP_014318909.1.81 WP_014318909.1.8291 WP_014318909.1.83106 WP_014318909.1.83614 WP_014318909.1.84071 WP_014318909.1.86739 WP_014318909.1.88098 WP_014318909.1.93774 WP_014318909.1.97137 WP_014318909.1.97735 gi|376290117|ref|YP_005162364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]