SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376290410|ref|YP_005162657.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376290410|ref|YP_005162657.1|
Domain Number 1 Region: 211-350
Classification Level Classification E-value
Superfamily CBS-domain pair 3.92e-26
Family CBS-domain pair 0.0064
Further Details:      
 
Domain Number 2 Region: 361-456
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.48e-17
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|376290410|ref|YP_005162657.1|
Sequence length 464
Comment hypothetical protein CDC7B_1207 [Corynebacterium diphtheriae C7 (beta)]
Sequence
MDILLSILSLLGFVLLTASTGLFVAIEFALTSLERSTIETEVKERGDKKSRAVQRDYQNL
SFVLSGAQLGITITTLATGYLAEPVLAKFLTPLLELMGLEASTSVAVALVLALMIATFLS
MVFGELLPKNVAITNPMGTARHVVGPVNAFNTVFKGFIKFLNHSANWAVRKMGIEPADEL
ATARSTQELTAIVKSSAETGDIDENTALVLDRSLKFGETTAGELMTPRSTVEVLSAEDTV
LDLIALAIETGHSRFPVIRGDLDDTIGVVHFKDAFSVPEDQRHVIPLSSIARPVPIIPES
LDGDAVLNAVRSAGSQIILVADEYGGTSGLITIEDVVEEILGEVYDEHDDADAERDFNKF
GNSWEVSGLARIDEVAKTIGYVAPDGPYETLGGLVMQVLGRIPETNDELLLPESDNPALA
EFESGYSCRWLAKVSAMEDRRVDKVIISPLQDDEVPQYEKEQNS
Download sequence
Identical sequences A0A0D6G5B4
gi|376293229|ref|YP_005164903.1| WP_014303387.1.100106 WP_014303387.1.100437 WP_014303387.1.10059 WP_014303387.1.12077 WP_014303387.1.16198 WP_014303387.1.16616 WP_014303387.1.20592 WP_014303387.1.25161 WP_014303387.1.26586 WP_014303387.1.27503 WP_014303387.1.27633 WP_014303387.1.31012 WP_014303387.1.33228 WP_014303387.1.33434 WP_014303387.1.33864 WP_014303387.1.35693 WP_014303387.1.36295 WP_014303387.1.36771 WP_014303387.1.37348 WP_014303387.1.39547 WP_014303387.1.41054 WP_014303387.1.43515 WP_014303387.1.4460 WP_014303387.1.47154 WP_014303387.1.47392 WP_014303387.1.50680 WP_014303387.1.51796 WP_014303387.1.52812 WP_014303387.1.5502 WP_014303387.1.5645 WP_014303387.1.56495 WP_014303387.1.56555 WP_014303387.1.60808 WP_014303387.1.63997 WP_014303387.1.64345 WP_014303387.1.67038 WP_014303387.1.69457 WP_014303387.1.71214 WP_014303387.1.79950 WP_014303387.1.80154 WP_014303387.1.83106 WP_014303387.1.83857 WP_014303387.1.85489 WP_014303387.1.87428 WP_014303387.1.88098 WP_014303387.1.91773 WP_014303387.1.92257 WP_014303387.1.94018 WP_014303387.1.96386 WP_014303387.1.97137 WP_014303387.1.97735 gi|376290410|ref|YP_005162657.1| gi|375293086|ref|YP_005127625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]