SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376290649|ref|YP_005162896.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376290649|ref|YP_005162896.1|
Domain Number 1 Region: 232-365
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000783
Family N-acetyl transferase, NAT 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376290649|ref|YP_005162896.1|
Sequence length 374
Comment hypothetical protein CDC7B_1449 [Corynebacterium diphtheriae C7 (beta)]
Sequence
MLDVYEFHRPKPSCNVALLEPSDELRSFVFSSNLAAQDITGDIATSCSATTVLAALQGSY
AQYSRIFGVFSVENNAVQNKHKNSILNLPSTTDDSPSDVAGFPLAYVETEVYLAADTKVL
AANIVLDAELQPLEDEDLDEEAQQALTRCFDLLSETALEMRRPIIHVQLPYGKVATSAHN
FCVNQLMQHGYRLAHEEIHGYVVMPLALERVENIHTECFENSEFPDEIIPGILELLNQSN
TDIPTGDLLRQPQPWTLQRLQQSATAHKKRGNRTLTTVLRDDSGCVLALSEALQRCHSSA
DLAEQGITIVDCDHRNQGYGTRVKAAALKNIHNNWPKVKRVFSDYSSHNTRMGSINSRLG
FQRVSATQIWQLTL
Download sequence
Identical sequences A0A0D6GFU9
gi|376287961|ref|YP_005160527.1| WP_014302037.1.10059 WP_014302037.1.101620 WP_014302037.1.12077 WP_014302037.1.13923 WP_014302037.1.14799 WP_014302037.1.20047 WP_014302037.1.27503 WP_014302037.1.31012 WP_014302037.1.33228 WP_014302037.1.33967 WP_014302037.1.36771 WP_014302037.1.41054 WP_014302037.1.41144 WP_014302037.1.43515 WP_014302037.1.47392 WP_014302037.1.48478 WP_014302037.1.49767 WP_014302037.1.50903 WP_014302037.1.51796 WP_014302037.1.52799 WP_014302037.1.5502 WP_014302037.1.55162 WP_014302037.1.60808 WP_014302037.1.63803 WP_014302037.1.67038 WP_014302037.1.67504 WP_014302037.1.67527 WP_014302037.1.69457 WP_014302037.1.70128 WP_014302037.1.7622 WP_014302037.1.76681 WP_014302037.1.79950 WP_014302037.1.88098 WP_014302037.1.92257 WP_014302037.1.92337 WP_014302037.1.94633 gi|375291114|ref|YP_005125654.1| gi|376257345|ref|YP_005145236.1| gi|376254535|ref|YP_005142994.1| gi|376290649|ref|YP_005162896.1| gi|376243049|ref|YP_005133901.1| gi|376245946|ref|YP_005136185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]