SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376290808|ref|YP_005163055.1| from Corynebacterium diphtheriae C7 (beta)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376290808|ref|YP_005163055.1|
Domain Number 1 Region: 19-172
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000015
Family N-acetyl transferase, NAT 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376290808|ref|YP_005163055.1|
Sequence length 192
Comment hypothetical protein CDC7B_1608 [Corynebacterium diphtheriae C7 (beta)]
Sequence
MVYVAITIVRVPGPAFSYHCPDFVRLYIEAMGYSPTIAPARIRVWRNAITEQGFVAVCAI
DDSSDNPAAIGEGIVGIGYGFTGRSEHWWDRQIHRGLAEQKCPPVARPYFELAELHVSPR
AQGQGIGRSLLHALIKHCGHELILLSTPEVPDEKNAAFHLYRSCGFDDLLRNFMFEGDRR
PFAVLQRKAHRN
Download sequence
Identical sequences A0A0D6GKZ9
WP_014310614.1.10059 WP_014310614.1.12077 WP_014310614.1.12973 WP_014310614.1.14626 WP_014310614.1.14870 WP_014310614.1.18214 WP_014310614.1.20592 WP_014310614.1.22463 WP_014310614.1.22666 WP_014310614.1.27503 WP_014310614.1.27633 WP_014310614.1.31012 WP_014310614.1.33434 WP_014310614.1.34190 WP_014310614.1.35091 WP_014310614.1.35790 WP_014310614.1.37348 WP_014310614.1.37559 WP_014310614.1.41076 WP_014310614.1.43515 WP_014310614.1.4460 WP_014310614.1.47392 WP_014310614.1.48478 WP_014310614.1.4993 WP_014310614.1.50438 WP_014310614.1.50680 WP_014310614.1.51796 WP_014310614.1.52812 WP_014310614.1.5502 WP_014310614.1.5692 WP_014310614.1.57575 WP_014310614.1.60808 WP_014310614.1.63803 WP_014310614.1.63997 WP_014310614.1.67038 WP_014310614.1.67199 WP_014310614.1.69457 WP_014310614.1.71214 WP_014310614.1.73040 WP_014310614.1.73879 WP_014310614.1.79950 WP_014310614.1.80154 WP_014310614.1.81989 WP_014310614.1.81997 WP_014310614.1.83056 WP_014310614.1.8401 WP_014310614.1.85108 WP_014310614.1.85489 WP_014310614.1.87428 WP_014310614.1.88098 WP_014310614.1.91773 WP_014310614.1.92257 WP_014310614.1.93436 WP_014310614.1.96386 WP_014310614.1.97735 gi|376254698|ref|YP_005143157.1| gi|376290808|ref|YP_005163055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]