SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:11053 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:11053
Domain Number 1 Region: 16-93
Classification Level Classification E-value
Superfamily E set domains 0.00000000000746
Family AMPK-beta glycogen binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:11053
Sequence length 189
Comment YIL024C, Contig c607 7319-7888 reverse complement
Sequence
MSNFLLVIPEDVIKGCSKADKLVVTGEFDNWRHSDYVLQYDGSAQNYRVQIPRRKGQRST
MFKVVINDKEWVTLNYFDTVTDKSGYTNNILHFKDNEASQLMDIPLSPHTRSNTVKGKPE
DDSLNDYVNLSSHSDLSSTEEIVCWNSDMEDENLDATIQCDFHQAFNSRKESLNGLMCIA
KKVKTYWNK
Download sequence
Identical sequences ORFP:11053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]