SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:13590 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:13590
Domain Number 1 Region: 703-786
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-20
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 504-589,622-644
Classification Level Classification E-value
Superfamily E set domains 5.88e-17
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:13590
Sequence length 1081
Comment YKL020C, Contig c109 60696-63941 reverse complement
Sequence
MMSGTGNVPALLHSYNTDIQRNGGTPDLDLLESELLDIALLNPVSSMQDPGLLSSNQEKI
MAATTIAPVKENEEELRDDVQSLQGLLDRHIQFGRKLPLRTPYANPLDFVNINPQSLPLS
LEIIGLPKVSRVETQMKLSFRIKNSHSRKNFFLHLPSDCIAKDKFFTSSDDPTNLAITNK
DISERTLFLDAFLLCASNSNSNNYKQTYVCNRCTNREKRRASRRKSGLNDNSIWQNNENK
RAIIFNSKQLFIVSNNGLDGSSNAANFDLPTRIVCYCRHHKATNGFVVLFLLKDHNGDIL
AKTITDPIMIMDKKNASNTTTPTSTNNAQVSPMTNDTRSFSSPQSDLNFPSEFPIPLNNK
NFVISSNFILDGNCNNDDNNNKNDNNFKNNINNITATNNNDRHFPSPKSSSEDSNHSFSD
IHFSSNNDNNFHHSLDSWSSTGRNSSSNPALTTLTSDFSTTSVRNSSKRQRSTNEPFMST
PSSFSRLPQNFVDSSKHVSNHSSFSMHLNNKPSIQRVIPAQGSVNGGIEVTLLGSNFKQG
LIIKFGENIALSSQCWNESTMVTYLPPSSKPGPVLVTIVDSNEASMRNNSNTSISTNNSG
NDILHSNKYTGDKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGSDSSTS
NNNARSGTQNISPNSYTSMMRNINDEQLIIEVIRSFKKNNNLSTVNLSMCDVRGRTLLHL
AAFNNWYSLVSLLIKYGSHLNDQDVFGFTPLHMACINGDLRIIRLLLECNVNFMKKTKNG
FVAKQFFLMNYTVNKTRYPNYETALFDDILTKLTKSTTVFVHSQPFERNASQSSFNSSLF
DDDVDHEQERNYFPINSSVPTSEPPNCNDNASFAIMDSDSGYDISDCESSSDEIALEFFN
SHKIKDASSEDNQHRKSTKTSAEQDDSLWNRMLTRLNDELPTYEDLFPKKSKNWETGSKS
VEIGSNYTQIIVDDPQTSSEDDELEALQIGFNTISKKQNFQNDKMLLFFWIPLTLVLLIC
FTLSKLGKDDDMFHNLSKIVQEYLRIGLAKVLLGNERMKASFKMQLSNFQNNNILNDMRA
N
Download sequence
Identical sequences ORFP:13590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]