SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:18243 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:18243
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily E set domains 5.83e-16
Family AMPK-beta glycogen binding domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:18243
Sequence length 362
Comment YNL173C, Contig c421 2587-3675 reverse complement
Sequence
MQPNLPQFTFKWPKGPETVILTGGFDEWKGTLPMVKDPNGAFEITLPIKFDSVGSKVYFK
FIVDGQWLPNKDYKVIVDGGVENNFITEDDVMQQYGNNTGMLVPESGGLAVTKNTTLIEP
EAEKPTKLRKFKIKRVIKTNKQTGERSIFSQEVIEVPESEDEAQKVDKTSKNADGLSGTT
TIIENNSTGVTEEKAVKPYEEGPAKLNFAKNEKYITDGLGKTKSSESRLYELSAEELENE
EEEEDEDKDAGTNTEGEDSELQSKKSLSIAARIESSPEKLPVGSTTSTAKETSRKSTGEV
IADTQTFEPKPSPTTAATEKVEVKKATTVAKPSHTKGTPKKDVQKSPVKKEGFFKKLSKI
LK
Download sequence
Identical sequences ORFP:18243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]