SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:20120 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORFP:20120
Domain Number - Region: 44-113,154-225
Classification Level Classification E-value
Superfamily E set domains 0.00021
Family Arrestin/Vps26-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:20120
Sequence length 837
Comment YOR018W, Contig c826 775-3288 reverse complement
Sequence
MFSSSSSSRPSKEPLLFDIRLRSLDNDVLLIKGPPDEASSVLLSGTIVLSITEPIQIKSL
ALRLFGRLRLNIPTVLQTVHGPHKRYSKFERNIYSHFWDDFNIKSYFQNLYDNHNNGKMT
ISSKSSTNLAALPIRKRSLSTASLISSNGQTSTSKNYHTLVKGNYEFPFSAIIPGSLLES
VEGLPNAAVTYTLEATIERPKQPDLICKKHLRVIRTLATDAVELSETVSVDNSWPEKVDY
TISIPSKAIAIGSSAMINILIVPVLKGLKLGPIRISLMESSQYCGSFGGIISQERVVAKL
KLRDPLKHVAQIKKRRSLNEGADGGIDTDIGEFQDKWEVQALLNIPASLTKCSQDCRILS
NIKVRHKIKFTISLLNPDGHISELRAALPVQLFISPFVPVNVKTSDVIERTLSTFGPSYK
VSSQHDNSFSNKSFTNDTEEDVIFQRSVSALQLSSMPTIVSGSILNINNTDAEASTATDA
TMVTSLMVPPNYGNHIYDRVYGEVTNQDETSTPAPIAAIESQALHDIQNLYISDSNNSNN
SNKQFLAPNPQIKIEGDRLNNCESRGDSVNNSSLNLVNNYSTVGDSGNSNSTYGNRYNPN
INAGLNSPSLTPSFAHLSRRNSYSRQTSSTSLKNELELTDLSRVPSYDKAMKFDMIGEDL
PPAYPEEEVDIQENKKTELERPQILHHKSTSSLLPLPGSSKSSNNVKSSSSRTYLSHSPL
PKNKNGSSVSLQQLTRSNTDSSFNLNLSFTSTKNGSGSRHFPFNMTPSLANNSGTKNNSF
IDKTEPKQKAEDNSMNPTDTRRSRSSSFRSNNSNSPLRQGTGSFANLMEMFTKRDRS
Download sequence
Identical sequences ORFP:20120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]