SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:21014 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:21014
Domain Number 1 Region: 37-65,100-140,175-217
Classification Level Classification E-value
Superfamily E set domains 0.0000000000224
Family Sec63 C-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:21014
Sequence length 269
Comment Multiple, Contig c490 45-854
Sequence
MFTLEDAIIGEVLGIKDQAKLNETLRIASHIPNLKIIKAEFLVPGENQVTPLSTPYISLK
VLIRSAKQPLLPTSLIPEDKLTEPQDFESQRDPFAMMSKQPLVPFSFAPFFPTKRRGSWC
CLVISQKDGKILQTPIIIEKLSYRNLNDDKSFFDKRIKLDLTKDEKFDVNDWEIGTIKIP
LGQPAPEIVGDFFFRVIIKSTDYFTTDLDITMNMKVRDLPVVEEVDVYSEEDDDYSSDED
ESESEDESDASDYTDIDTDTDAEEDESSE
Download sequence
Identical sequences ORFP:21014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]