SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:21569 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:21569
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily E set domains 0.0000000000231
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:21569
Sequence length 88
Comment YPL186C, Contig c16 1-264 reverse complement
Sequence
MVTIVFPHPAEDFPGLKIAGEFTDWKGVPMSINAETGQWEYKIDESSIAKHNDKDKVHFK
FIDHNGNWFADDEYAKEIDEHSNENNVA
Download sequence
Identical sequences ORFP:21569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]