SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:2721 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:2721
Domain Number 1 Region: 11-201
Classification Level Classification E-value
Superfamily E set domains 3.85e-61
Family RhoGDI-like 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:2721
Sequence length 201
Comment YDL135C, Contig c188 8952-9557 reverse complement
Sequence
MAEETPDFSQFEDRNNDQYKVSAKKTVDEYKNLDAEDESLAKWKESLGLSSDVLPLEFPG
DKRKVVVQKIQLLVNTEPNPITFDLTNEKTIKELASKRYKIKENSIYKLKIVFKVQHEII
TGLRYVQYIKKAGIAVDKIDDHLGSYAPNTRTKPFYEVELPESEAPSGFLARGNYSAVSK
FIDDDKTNHLTLNWGVEIVKK
Download sequence
Identical sequences ORFP:2721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]