SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:4894 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORFP:4894
Domain Number - Region: 252-300
Classification Level Classification E-value
Superfamily Gam-like 0.0785
Family Gam-like 0.02
Further Details:      
 
Domain Number - Region: 172-264
Classification Level Classification E-value
Superfamily E set domains 0.0924
Family Arrestin/Vps26-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:4894
Sequence length 523
Comment YBR250W, Contig c697 8399-9970
Sequence
MLFSTSSSSLNSEVSQVLSENIPSRSSTLTRNSTQSQINEDVRSENFTDQLPKKLIQLKK
LKNGGTTIKRAKEDLEYCYDSLRLYENPYVTTSIDKKCGYSIEMCLENKYKTLMFSDLQL
NTDYPLYYDSSLNHLSTNNERENVTPLQIKGKIRINIDRDDQVLLITSQTISLKCFTKEY
ACFIDSGAGENSKINKIIKELNHTEFFESSTYPKQQLKVTHHSLCDKKILLTKGTYDYPF
TFTLQSNTFPATFSSFFGKTHFRIESSTSIMRIPSRPKNFLKFLKNESITDKIILTEEIR
VKRVLPSTCMLKFEMFQLRSYNTASDVVVSVIGNSKLIEIGTPFQMILSISKTDSTIELQ
EASLSVAQRMAIPSIDSKTKKILQEPYIKKSEYLLRTVESQSFDSDKTIFGFCFDDVVIP
NYVDGLPSWFKTFYCEPSSFYPNYAALKVTHLLLFKINYSRNEMVEGIEVRKNYRITVNF
PILVGDSDISTSSLLPKYEMFENISDLQDEPPLYSVVTGGSGC
Download sequence
Identical sequences ORFP:4894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]