SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:7032 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:7032
Domain Number 1 Region: 308-412
Classification Level Classification E-value
Superfamily AMPKBI-like 3.66e-32
Family AMPKBI-like 0.00000122
Further Details:      
 
Domain Number 2 Region: 163-246
Classification Level Classification E-value
Superfamily E set domains 9.1e-23
Family AMPK-beta glycogen binding domain-like 0.00000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:7032
Sequence length 415
Comment YGL208W, Contig c996 22860-24107
Sequence
MGTTTSYPTHQNQTIGKSRTIIMNGATEKAGNSQGSEPQEMDAVSKKVTELSLNGSSCSK
DVEKLPGEGSMTKKKSTLLLREEDEPAMPELSVVETAMDTESESSSSSDNESGDIVAQTT
GSRQDTSAGVDPSTPYSPARKGRQQMDSKERLEGSTEIKSSLMVPVEIKWQQGGSKVYVT
GSFTKWRKMIGLIPDSKHSGAFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFV
NYIEVREPEKKATDGKRKSKKEYSIQAPTSDRSSIALQIGKDPDDFGDGYTRFHEDFSPR
PPQEYTADIPAVFSDPSVMERYYYTLDREQNHNDTSWLTPPLLPPQLENVILNKYYMTQD
QFNENNSGALPIPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYAPIESS
Download sequence
Identical sequences ORFP:7032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]