SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:7473 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ORFP:7473
Domain Number - Region: 42-123,150-212
Classification Level Classification E-value
Superfamily E set domains 0.0077
Family Arrestin/Vps26-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:7473
Sequence length 732
Comment YFR022W, Contig c268 7235-9433 reverse complement
Sequence
MGFSNSKSTKKPLLFDIRLKNVDNDVILLKGPPHEAPSVLLSGCIVLSINEPMQIKSISL
RLFGKIQIDVPLEKRQETNSSSLSSPPPKVRKYNKVFYSHAWDNVNLKEYLSGSKGQAGS
VGSSSSSNILGIHQRAQSTSSLKSLKGSSRPTSYTLDKGNYDFPFSAILPGSLPESVESL
PNCFVTYSMESVIERSKHYSDLICRKNMRVLRTISPAAVELSETVCVDNSWPNKVDYSIS
VPNKAIAIGSATPINISIVPLSKGLKLGSIRVVLFEKYQYCDPFPPVISEDRQVTELTLE
NPLYRSSEEFNVDGNYVDNPFFEADHSFQDKWEIDTILQIPSSLSNCVQDCDIRSNIKVR
HKLKFFIMLINPDGHKSELRASLPIQLFISPFVALSVKPLSSSNLYSLSGATNQKDENML
QEDEEEYLFSRSASVTGLELMADMRNGTAVPTISDLMTPPNYEMHVYDRLYSGSFNHAPA
ETSGACTPLESECSATEDQEQDLEDLRIRLTKIRDQRENLGLPVSASSAAVSRSLSPLLN
VPEQEGGLDRSSPQSSIGPNNSSASLAHNNVSPILLSRSPAASVSVHEVLPVPSGLSYLE
IQNMNKVPSYGKAMKYDIIGGDLPPTYPCAIQNVQPRKPSRVHSRNSSATLSSSIPTSFH
SSSFLSSAASPISIINGSRSSSSGVSLNTLNELTSKTSNNPSSSSIKRSPTRQRASSLAG
FMGGFLSKGNKR
Download sequence
Identical sequences ORFP:7473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]