SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:12002 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:12002
Domain Number 1 Region: 44-169
Classification Level Classification E-value
Superfamily E set domains 0.0000287
Family Arrestin/Vps26-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:12002
Sequence length 379
Comment YJL053W, Contig c340 3747-4886
Sequence
MSIFFKSPIDIEILFDNEESRKHVDVATRTSNSSYKSMKESLPVYEDGESLGGIVTLRVR
DGKKVEHLGIKVSVIGSIDMIKSHSSGTSSTKKATSSTSSTSSNVSADVRKNSVDQFLCQ
SYDLCSAGELQHSQSFPFLFRDLSKRYESYKGRNVDVAYFVKVTVMRKSTDISKVKRFWV
YLYNSITTAPNTLSANEIQSNPKDINSESNTADNANQNKSIKGAQGGAADGNQVLPISHS
GNEPKPVRLDIGIENCLHIEFEYAKPQYSLKEVIVGRIYFLLTRLRIKHMELSLITRESS
GLQTSNVMTDSTAIRYEIMDGSSVKGETIPIRLFLSGYDLTPNMSCNYFNVKNYLSLVII
DEDGRRYFKQSEITLYRTR
Download sequence
Identical sequences ORFP:12002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]