SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:13072 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:13072
Domain Number 1 Region: 118-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.6e-65
Family G proteins 0.0000768
Further Details:      
 
Domain Number 2 Region: 679-860
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.26e-33
Family Translational machinery components 0.00027
Further Details:      
 
Domain Number 3 Region: 467-589
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000115
Family Elongation factors 0.0054
Further Details:      
 
Domain Number 4 Region: 601-675
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000755
Family EF-G/eEF-2 domains III and V 0.0007
Further Details:      
 
Domain Number 5 Region: 861-949
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000115
Family EF-G/eEF-2 domains III and V 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:13072
Sequence length 1010
Comment YKL173W, Contig c1015 15948-18980 reverse complement
Sequence
MEGDDLFDEFGNLVGVNPLDSDEEEEEVLDEQELYETDITGESGDKNGIKANQFISVGND
KGVGTDLGYPYGKGVEVLIETENTQSVKTPLVKPVAERSKLQEHTIFTQLKKNIPKTKYN
RDYMLSMTDIPERIINVGVIGPLHSGKTSLMDLLIIDSHKRIPDMSKNTELGWKPLRYMD
NMKQEIDRGISIKLNGSTLLCTNLESKSNIINFLDAPGHTNFIDETAVAFAASDLALIVI
DVVEGVTSVVEQLIKQSIRNKLAMCFVINKLDRLILDLKLPPMDAYFKLNHIIKDINSFT
KGQVFSPAYNNIIFASAKLGFTFTVKEFVAYNYSHSIPPSKIDDFITRLWGSVYFHKGNF
QSKPFDSVEGYPTFVEFILNPIYKIFSYALSMEKDKLKNLLRNSFRINLRHEVLKYDPQP
FLKHVLQLIFKEQTGLVDSITRCYEPLTLTDNKVNQLSSPGKHTSKDILWAHVLKTLDYG
GTEWSLVRIYSGLLKRGDKVRILDTSQSESRQKRAIINNTEIESFDKEEDGDDDETPMCT
VEEIGLLGGRYVYPLSKAHKGQIVLVKGISSAYIKSATLYSVKNKEDMKTLKYFRPLDYI
TEAVFKIVLQPLLPKELPKLLHGLNKVTKYYPGVVVKVEESGEHVILGNGELYMDCLLYD
LRTRYADIEIKISDPLTVFSESCSNESFASIPVNNSISRLNDESSLGLAISVTAEPLDFK
MIQDLSKNVLGKGQNYLNIDEIIDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDT
LPGEVSPELLSEYKQQIIQGFYWAVKEGPLAEEPIYGVQYKLLSITIPSDTNIDVIKSQI
IPLMRKACYVGLLTATPALLEPVYEVNITVHAPLLPIVEELVKKRRGSRIYKTIKVVGTP
LMEIRGQIPVIESPGFEIDLRLCTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKAAP
VNSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELFVQLRENGLIP
Download sequence
Identical sequences ORFP:13072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]