SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:17361 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:17361
Domain Number 1 Region: 56-521
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.39e-105
Family Pyridoxal-dependent decarboxylase 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:17361
Sequence length 585
Comment YMR250W, Contig c464 803-2560
Sequence
MLHRHSSKQKNFESMAGKVVHDLAGLQLLSNNVRKSAIQSDHHGTTKLRDNGPQGMASKY
SVPKKGLPADLSYQLIHNELTLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLADNDEY
PQLIELTQRCISMLAQLWHANPEEEPIGCATTGSSEAIMLGGLAMKKRWEHRMKDAGKDV
SKPNIIMSSACQVALEKFTRYFEVECRLIPVSHKSHHMLDPDSLWDYVDENTIGCFVILG
TTYTGHLENVEKVADVLSQIEAKHPDWSNIDIPIHADGASGGFIIPFGFEKEHMKAYGLE
RWGFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDESLLADELKFKLKYLGGVEETFGLNFS
RPGFQVVHQYFNFVSLGHSGYRTQFQNSLFVARAFSFELLNSSKLPGCFEIVSSIHERIE
DDSTPESVKDYCEHPQAYKPGVPLVAFKLSKKFHEEYPEVPQAILSSLLRGRGWIIPNYP
LPKATDGSDEKEVLRVVFRSEMKLDLAQLLIVDIENILTKLIHSYEKVCHHIGLASEQTP
ERKSSFIYEMLLALASPQEDIPSPEETERKNKLRERTTRNYRGTC
Download sequence
Identical sequences ORFP:17361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]