SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:17538 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:17538
Domain Number 1 Region: 143-457,496-547
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.72e-62
Family GABA-aminotransferase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:17538
Sequence length 558
Comment YMR296C, Contig c470 19009-20685 reverse complement
Sequence
MAHIPEVLPKSIPIPAFIVTTSSYVWYYFNLVLIQIPGGEFIVSYIKKSHHDDPYRTTVE
IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAT
TPVTMEMPIQNHITITRNNLKEKYTGVFNLASNNFLQLSATEPVREVVTTTIKNYGVGAC
GPAGFYGNQDVHYTLEYDLAQFFGTQGAVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL
SVQNALQLSRSTVYYFNHNDMDSLESLLNELTEQEKAEKPPAIPRKFIVTEGIFHNSGDL
APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS
TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNHDAVQALQKLSKSL
HGFFASDDSLRPYVVITSSPVSPVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSHTNK
YIEPYEEEEKFLQAIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKD
ACESVKQSIVACCQETNK
Download sequence
Identical sequences ORFP:17538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]