SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:4055 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:4055
Domain Number 1 Region: 77-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.18e-101
Family GABA-aminotransferase-like 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:4055
Sequence length 548
Comment YDR232W, Contig c228 3055-4701 reverse complement
Sequence
MQRSIFTRFGNSSATVSALNRLSTTAAPHAKNGYATTTGAGAAGATATASSTNAAAAAAA
AANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCS
NDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTMNLEAELATLHKKEGALVFS
SCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFRHNDLNELEKLLQS
YPKSIPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHC
DFESHRASGIATPKTNDKGMAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFA
PGFIFTTTLPPSVMAGATAAIRYQRCHLDLRTSQQRHTMYVKKAFHDLGIPVIPNPSHIV
PVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTDDLSDILINAV
DDVFNELQQPRVRDWENQGGLLGVGEAGFVEEPNLWTSSQLSLTNDDLNPNVRDPIIRQL
EVSSGIKQ
Download sequence
Identical sequences ORFP:4055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]