SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:4629 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:4629
Domain Number 1 Region: 130-537
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.93e-110
Family Pyridoxal-dependent decarboxylase 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:4629
Sequence length 589
Comment YDR294C, Contig c381 4266-6035
Sequence
MSGASNKTLSISGWYGMPFYLLREDCDFSQFMILIIGESRKGIYDYFRNTPWYNMLKDYL
FVIFCYKILSNFLYLLKVYGPIKLTVRTYEHTSRKLFRWLLNSPFLKGTVEKEVSKVKKS
IEDELIRSDSQLMNFPRLPSNGIPQNDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDL
IHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLKMFNAPSDTGCGTTTSGGTESLL
LACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVDLDSTTYQVDLKKVK
KFINKNTVLLVGSAPNFPHGIADDIEGLGEIAQKYNLPLHVDSCLGSFIVSFMEKAGYKN
LPFLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLA
GSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKSFIMENIPDLEIIGDPKYSVVS
FSSKTLNIHELSDRLAKKGWHFNALQKPTALHMAFTRLSANVVDDICNILRTTVQESRSE
SNTKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDSLYKLGPGEETDTE
Download sequence
Identical sequences ORFP:4629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]