SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:7768 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:7768
Domain Number 1 Region: 40-210
Classification Level Classification E-value
Superfamily E set domains 0.000000077
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:7768
Sequence length 542
Comment Multiple, Contig c273 6629-8257 reverse complement
Sequence
MSLLKLWNREARASSKRKSHGIAGNYGNSMLAHNNVRQFRIDINEAHRVWKPSENIAGEV
VIDIKRDITNVAIKLSLVCEVRVKTGNSPTSKNKRIEKVLEKSTFLYGQDYVKADFSTTE
KKPCIGKATILNGLSKGEHRFPFRIKIPRGKGMLSSIKFERGSITYFLTSSLEYLNNINA
LKKPEARCEREFAVIVPLDVSRLPQPKTKTVVLQSASMVQNKKGKSTEDASSSYTQLTQK
SNTSNSSGSSTNSKTPPLPNKTVTISVDIPQAGFMIGEIIPIDVRIDHYKPFYAPAGLTT
TLVRICRVDGAGKDDPMETFRKDICQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVS
KFFSFQYYIEVMVNLSKKNVVYTESNKIIGTPIEEQNGLGVENNINRIQRKMLRMVSPET
LENDSEGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTTRSEQQRYDTYFPLPSSTRI
PQSPLSDLKEWLTPLNAYECDDVPVPKYFPNSEVDIPSEDKQELERRRLQQLESDPPLCD
DY
Download sequence
Identical sequences ORFP:7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]