SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:8528 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:8528
Domain Number 1 Region: 269-554,596-647
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.2e-85
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:8528
Sequence length 651
Comment YGR083C, Contig c524 16961-18916 reverse complement
Sequence
MSEAEVKSGSATPASKAKQAAPTITSTDNGEKKLTNKELKELKKQEKAAKRAAMKQANGI
SIEQQQQQAQMKKEKKQLQREQQQKREQKQKSANKKKQNELNVKKSTLFGHLETTEERRA
TILALTSAVSSPKTSRITAAGLMVPVVASALSGSNVLTASSLMPMGSNASSAALTAAPAS
ATTTISTSSTAPSAGSNSASTNTPTAIQQEIASASASDVAKTLASISLEAGEFSVIPGIS
SVIPTVLEQSFDSSSLVSSVKELLLNKDLIHPSILLLTSHLAHYKIVGSIPRCIAMLEVF
QIVIKDYQTPKGTTLSRNLTNYLSHQIDLLKKARPLSVTMGNAIRWLKQEISLIDPSTPD
KAAKEDLCEKIGQFAKEKIELADQLIIGNASTQIENSTTIVTYGSSKVLTELLMHNAIGL
KKNIKVIVVDSRPLFEGRKMAETLRNAGVNVMYALITSLDTIFNMDVDYVFLGAHSILSN
GFLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLVNIDYENP
IERRGNKGALLNQFIKERKFEKKKLEMENKPKGNKIGGKKGSEGENKDANNEGDSNNKNI
LDDWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA
Download sequence
Identical sequences ORFP:8528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]