SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:3330 from Saccharomyces paradoxus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:3330
Domain Number 1 Region: 59-169
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.79e-36
Family Frataxin-like 0.000000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:3330
Sequence length 173
Comment YDL120W, Contig c103 3660-4181
Sequence
MIKRSLASIVRSSSVLSRRSMIAAAGGRVRFCPVVAKNTNRTVNTFQKRFVESSTDGQVV
PQEVLNLPLEKYHEEADIYLDNLLDSMEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVI
NKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAIAKSQ
Download sequence
Identical sequences ORFP:3330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]