SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376241949|ref|YP_005132801.1| from Corynebacterium diphtheriae CDCE 8392

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376241949|ref|YP_005132801.1|
Domain Number 1 Region: 50-299
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.7e-25
Family GpdQ-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|376241949|ref|YP_005132801.1|
Sequence length 301
Comment putative secreted protein [Corynebacterium diphtheriae CDCE 8392]
Sequence
MRLLKTLLGLTAATAATGAATLVWGYRECSNFELKTIDLPILEPGILRGNPHFSILHISD
LHMVPNQTTKQRWVAQLDKLNPDLVVNTGDNLSDAKAVPAVMQALSPLLKRPGVFVFGTN
DYFAPRMVNPFVYLLGKKRTPSRVELPWKGMRAAFIEHGWRDANQQRHEFKVDFLRLAIT
GVDDPHHDLDNYDDIAGAPNPDADLSIALTHSPEPRVLKKFEQDGYMLSLSGHTHGGQIC
LPGSRALVTNCGIDRPRVQGLHRFGSMWMHVSNGLGTSKFAPVRIFCKPSATLIRVTERT
L
Download sequence
Identical sequences WP_014306371.1.16198 WP_014306371.1.55162 WP_014306371.1.5645 WP_014306371.1.56555 WP_014306371.1.94018 gi|376241949|ref|YP_005132801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]