SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15607917|ref|NP_215291.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15607917|ref|NP_215291.1|
Domain Number 1 Region: 6-451
Classification Level Classification E-value
Superfamily L-aspartase-like 5.65e-82
Family L-aspartase/fumarase 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15607917|ref|NP_215291.1|
Sequence length 472
Comment Probable adenylosuccinate lyase PurB (adenylosuccinase) (ASL) (ASASE) [Mycobacterium tuberculosis H37Rv]
Sequence
MSIPNVLATRYASAEMVAIWSPEAKVVSERRLWLAVLRAQAELGVAVADSVLADYERVVD
DVDLASISARERVLRHDVKARIEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLEVIF
AHGVAAVARLAERAVSYRDLIMAGRSHNVAAQATTLGKRFASAAQEMMIALRRLRELIDR
YPLRGIKGPMGTGQDMLDLLGGDRAALADLERRVADFLGFATVFNSVGQVYPRSLDHDVV
SALVQLGAGPSSLAHTIRLMAGHELATEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMVAELAGAQWNEGDVFCSVVRRVALPDSFFAVDGQIETFLTVLDEFGAYPAVIGRE
LDRYLPFLATTKVLMAAVRAGMGRESAHRLISEHAVATALAMREHGAEPDLLDRLAADPR
LTLGRDALEAALADKKAFAGAAGDQVDDVVAMVDALVSRYPDAAKYTPGAIL
Download sequence
Identical sequences A0A045IPW7 A0A089QJT5 A0A0H3L6I7 A5U0G5 I6XWA1 P71832
Rv0777 gi|15840192|ref|NP_335229.1| gi|392385495|ref|YP_005307124.1| gi|471336634|ref|YP_007609347.1| gi|148660554|ref|YP_001282077.1| gi|15607917|ref|NP_215291.1| gi|494699166|ref|YP_007964648.1| gi|385997558|ref|YP_005915856.1| 336982.TBFG_10792 419947.MRA_0786 478434.TBMG_00792 83331.MT0801 83332.Rv0777 gi|506925202|ref|YP_008005652.1| gi|197739536|ref|YP_002160850.1| gi|375294998|ref|YP_005099265.1| gi|479313658|ref|YP_007853710.1| gi|479054730|ref|YP_007350536.1| NP_215291.1.84033 WP_003898583.1.100021 WP_003898583.1.100069 WP_003898583.1.100087 WP_003898583.1.10015 WP_003898583.1.100208 WP_003898583.1.100216 WP_003898583.1.10022 WP_003898583.1.100255 WP_003898583.1.100260 WP_003898583.1.100270 WP_003898583.1.100279 WP_003898583.1.100286 WP_003898583.1.100308 WP_003898583.1.100309 WP_003898583.1.100318 WP_003898583.1.100338 WP_003898583.1.10037 WP_003898583.1.100383 WP_003898583.1.100396 WP_003898583.1.1004 WP_003898583.1.100401 WP_003898583.1.100459 WP_003898583.1.100460 WP_003898583.1.100552 WP_003898583.1.100581 WP_003898583.1.100600 WP_003898583.1.100625 WP_003898583.1.10064 WP_003898583.1.100666 WP_003898583.1.100671 WP_003898583.1.100677 WP_003898583.1.100697 WP_003898583.1.100703 WP_003898583.1.100716 WP_003898583.1.100722 WP_003898583.1.100754 WP_003898583.1.100757 WP_003898583.1.100772 WP_003898583.1.1008 WP_003898583.1.100812 WP_003898583.1.100845 WP_003898583.1.100866 WP_003898583.1.10088 WP_003898583.1.100889 WP_003898583.1.10090 WP_003898583.1.100910 WP_003898583.1.100915 WP_003898583.1.100918 WP_003898583.1.100935 WP_003898583.1.100984 WP_003898583.1.100992 WP_003898583.1.100998 WP_003898583.1.101 WP_003898583.1.101025 WP_003898583.1.101028 WP_003898583.1.10104 WP_003898583.1.101048 WP_003898583.1.101054 WP_003898583.1.101075 WP_003898583.1.101143 WP_003898583.1.10116 WP_003898583.1.10117 WP_003898583.1.101209 WP_003898583.1.10125 WP_003898583.1.101290 WP_003898583.1.101323 WP_003898583.1.101324 WP_003898583.1.101350 WP_003898583.1.101367 WP_003898583.1.101398 WP_003898583.1.101403 WP_003898583.1.101421 WP_003898583.1.10144 WP_003898583.1.101442 WP_003898583.1.10145 WP_003898583.1.101452 WP_003898583.1.101456 WP_003898583.1.101481 WP_003898583.1.101493 WP_003898583.1.101496 WP_003898583.1.101525 WP_003898583.1.101533 WP_003898583.1.101535 WP_003898583.1.101553 WP_003898583.1.101558 WP_003898583.1.10156 WP_003898583.1.101573 WP_003898583.1.101576 WP_003898583.1.10159 WP_003898583.1.101592 WP_003898583.1.101604 WP_003898583.1.101607 WP_003898583.1.101622 WP_003898583.1.101644 WP_003898583.1.101659 WP_003898583.1.101671 WP_003898583.1.101687 WP_003898583.1.101698 WP_003898583.1.10170 WP_003898583.1.101713 WP_003898583.1.101722 WP_003898583.1.101733 WP_003898583.1.101743 WP_003898583.1.101753 WP_003898583.1.101754 WP_003898583.1.101764 WP_003898583.1.101773 WP_003898583.1.101795 WP_003898583.1.101797 WP_003898583.1.101798 WP_003898583.1.101802 WP_003898583.1.101826 WP_003898583.1.101836 WP_003898583.1.101858 WP_003898583.1.101859 WP_003898583.1.101888 WP_003898583.1.101894 WP_003898583.1.101899 WP_003898583.1.1019 WP_003898583.1.101923 WP_003898583.1.101925 WP_003898583.1.10193 WP_003898583.1.102 WP_003898583.1.102008 WP_003898583.1.102017 WP_003898583.1.102053 WP_003898583.1.102055 WP_003898583.1.102063 WP_003898583.1.102099 WP_003898583.1.1021 WP_003898583.1.10211 WP_003898583.1.102119 WP_003898583.1.102121 WP_003898583.1.102143 WP_003898583.1.10216 WP_003898583.1.10224 WP_003898583.1.10253 WP_003898583.1.10262 WP_003898583.1.10277 WP_003898583.1.1033 WP_003898583.1.10350 WP_003898583.1.10362 WP_003898583.1.10366 WP_003898583.1.10376 WP_003898583.1.10396 WP_003898583.1.10410 WP_003898583.1.10430 WP_003898583.1.1044 WP_003898583.1.10440 WP_003898583.1.10471 WP_003898583.1.10472 WP_003898583.1.10489 WP_003898583.1.105 WP_003898583.1.10518 WP_003898583.1.10523 WP_003898583.1.10545 WP_003898583.1.1057 WP_003898583.1.10594 WP_003898583.1.10603 WP_003898583.1.10606 WP_003898583.1.10615 WP_003898583.1.10623 WP_003898583.1.10635 WP_003898583.1.10643 WP_003898583.1.10648 WP_003898583.1.10662 WP_003898583.1.10709 WP_003898583.1.10735 WP_003898583.1.10740 WP_003898583.1.10756 WP_003898583.1.1078 WP_003898583.1.10791 WP_003898583.1.10799 WP_003898583.1.10825 WP_003898583.1.10848 WP_003898583.1.10863 WP_003898583.1.10879 WP_003898583.1.10912 WP_003898583.1.10916 WP_003898583.1.10923 WP_003898583.1.10927 WP_003898583.1.1095 WP_003898583.1.10956 WP_003898583.1.10958 WP_003898583.1.10962 WP_003898583.1.10980 WP_003898583.1.10981 WP_003898583.1.10993 WP_003898583.1.1100 WP_003898583.1.11040 WP_003898583.1.11061 WP_003898583.1.11070 WP_003898583.1.11171 WP_003898583.1.11175 WP_003898583.1.11176 WP_003898583.1.11222 WP_003898583.1.11236 WP_003898583.1.11329 WP_003898583.1.1133 WP_003898583.1.11342 WP_003898583.1.11373 WP_003898583.1.11376 WP_003898583.1.11390 WP_003898583.1.11402 WP_003898583.1.11481 WP_003898583.1.11487 WP_003898583.1.11489 WP_003898583.1.11514 WP_003898583.1.11589 WP_003898583.1.11596 WP_003898583.1.11604 WP_003898583.1.11610 WP_003898583.1.11697 WP_003898583.1.11707 WP_003898583.1.11752 WP_003898583.1.11758 WP_003898583.1.11761 WP_003898583.1.11775 WP_003898583.1.11804 WP_003898583.1.11822 WP_003898583.1.11826 WP_003898583.1.11856 WP_003898583.1.11898 WP_003898583.1.11906 WP_003898583.1.11939 WP_003898583.1.11960 WP_003898583.1.11961 WP_003898583.1.11972 WP_003898583.1.120 WP_003898583.1.12001 WP_003898583.1.12049 WP_003898583.1.12052 WP_003898583.1.12100 WP_003898583.1.12116 WP_003898583.1.12133 WP_003898583.1.12161 WP_003898583.1.12165 WP_003898583.1.12184 WP_003898583.1.12190 WP_003898583.1.12216 WP_003898583.1.12265 WP_003898583.1.12275 WP_003898583.1.12293 WP_003898583.1.12294 WP_003898583.1.123 WP_003898583.1.1231 WP_003898583.1.12314 WP_003898583.1.12327 WP_003898583.1.12338 WP_003898583.1.1236 WP_003898583.1.12371 WP_003898583.1.12372 WP_003898583.1.12389 WP_003898583.1.12406 WP_003898583.1.1241 WP_003898583.1.12421 WP_003898583.1.12446 WP_003898583.1.12464 WP_003898583.1.12479 WP_003898583.1.12519 WP_003898583.1.12523 WP_003898583.1.12526 WP_003898583.1.1255 WP_003898583.1.12550 WP_003898583.1.12551 WP_003898583.1.12563 WP_003898583.1.12611 WP_003898583.1.12669 WP_003898583.1.1267 WP_003898583.1.12672 WP_003898583.1.12692 WP_003898583.1.1271 WP_003898583.1.12768 WP_003898583.1.1279 WP_003898583.1.12794 WP_003898583.1.12804 WP_003898583.1.12821 WP_003898583.1.12841 WP_003898583.1.12854 WP_003898583.1.12871 WP_003898583.1.12901 WP_003898583.1.12941 WP_003898583.1.12947 WP_003898583.1.12957 WP_003898583.1.12972 WP_003898583.1.13028 WP_003898583.1.13043 WP_003898583.1.13086 WP_003898583.1.13087 WP_003898583.1.13090 WP_003898583.1.13096 WP_003898583.1.13163 WP_003898583.1.13175 WP_003898583.1.13183 WP_003898583.1.132 WP_003898583.1.13249 WP_003898583.1.13282 WP_003898583.1.13284 WP_003898583.1.13296 WP_003898583.1.13298 WP_003898583.1.13306 WP_003898583.1.13312 WP_003898583.1.13313 WP_003898583.1.13321 WP_003898583.1.13345 WP_003898583.1.13358 WP_003898583.1.13370 WP_003898583.1.13375 WP_003898583.1.1338 WP_003898583.1.13420 WP_003898583.1.13433 WP_003898583.1.13435 WP_003898583.1.13438 WP_003898583.1.13461 WP_003898583.1.13466 WP_003898583.1.13489 WP_003898583.1.13551 WP_003898583.1.13561 WP_003898583.1.13564 WP_003898583.1.13579 WP_003898583.1.13647 WP_003898583.1.13687 WP_003898583.1.13697 WP_003898583.1.13719 WP_003898583.1.13763 WP_003898583.1.1377 WP_003898583.1.13774 WP_003898583.1.13786 WP_003898583.1.13793 WP_003898583.1.13794 WP_003898583.1.13817 WP_003898583.1.13834 WP_003898583.1.13866 WP_003898583.1.13880 WP_003898583.1.13899 WP_003898583.1.13909 WP_003898583.1.13910 WP_003898583.1.13919 WP_003898583.1.13920 WP_003898583.1.13952 WP_003898583.1.13953 WP_003898583.1.13962 WP_003898583.1.1398 WP_003898583.1.13988 WP_003898583.1.14027 WP_003898583.1.14046 WP_003898583.1.14115 WP_003898583.1.1415 WP_003898583.1.14152 WP_003898583.1.14158 WP_003898583.1.14162 WP_003898583.1.14175 WP_003898583.1.14178 WP_003898583.1.14194 WP_003898583.1.14195 WP_003898583.1.14208 WP_003898583.1.14238 WP_003898583.1.14266 WP_003898583.1.14273 WP_003898583.1.14303 WP_003898583.1.14306 WP_003898583.1.14307 WP_003898583.1.14310 WP_003898583.1.14382 WP_003898583.1.14416 WP_003898583.1.14428 WP_003898583.1.14441 WP_003898583.1.14469 WP_003898583.1.14477 WP_003898583.1.14504 WP_003898583.1.14514 WP_003898583.1.1452 WP_003898583.1.14527 WP_003898583.1.1454 WP_003898583.1.14544 WP_003898583.1.14548 WP_003898583.1.14551 WP_003898583.1.14561 WP_003898583.1.14573 WP_003898583.1.1462 WP_003898583.1.14667 WP_003898583.1.14668 WP_003898583.1.14675 WP_003898583.1.14694 WP_003898583.1.14695 WP_003898583.1.14709 WP_003898583.1.14766 WP_003898583.1.14783 WP_003898583.1.14865 WP_003898583.1.14872 WP_003898583.1.14905 WP_003898583.1.14926 WP_003898583.1.14951 WP_003898583.1.14955 WP_003898583.1.15003 WP_003898583.1.15009 WP_003898583.1.15028 WP_003898583.1.15040 WP_003898583.1.15052 WP_003898583.1.15065 WP_003898583.1.15072 WP_003898583.1.15089 WP_003898583.1.1509 WP_003898583.1.15126 WP_003898583.1.15131 WP_003898583.1.15168 WP_003898583.1.15174 WP_003898583.1.15187 WP_003898583.1.15196 WP_003898583.1.15210 WP_003898583.1.15216 WP_003898583.1.15217 WP_003898583.1.1523 WP_003898583.1.15232 WP_003898583.1.15238 WP_003898583.1.15240 WP_003898583.1.15253 WP_003898583.1.1527 WP_003898583.1.15292 WP_003898583.1.15299 WP_003898583.1.15302 WP_003898583.1.15322 WP_003898583.1.1534 WP_003898583.1.15365 WP_003898583.1.15386 WP_003898583.1.15387 WP_003898583.1.15442 WP_003898583.1.15447 WP_003898583.1.15449 WP_003898583.1.15477 WP_003898583.1.15481 WP_003898583.1.15492 WP_003898583.1.15511 WP_003898583.1.15512 WP_003898583.1.15558 WP_003898583.1.15559 WP_003898583.1.15566 WP_003898583.1.15599 WP_003898583.1.1560 WP_003898583.1.15611 WP_003898583.1.1563 WP_003898583.1.15633 WP_003898583.1.15643 WP_003898583.1.15688 WP_003898583.1.15755 WP_003898583.1.15763 WP_003898583.1.15774 WP_003898583.1.1578 WP_003898583.1.15780 WP_003898583.1.15834 WP_003898583.1.15842 WP_003898583.1.15848 WP_003898583.1.15853 WP_003898583.1.15870 WP_003898583.1.15877 WP_003898583.1.15893 WP_003898583.1.15896 WP_003898583.1.15926 WP_003898583.1.15933 WP_003898583.1.15946 WP_003898583.1.15958 WP_003898583.1.15973 WP_003898583.1.15987 WP_003898583.1.15993 WP_003898583.1.16025 WP_003898583.1.16043 WP_003898583.1.16066 WP_003898583.1.16069 WP_003898583.1.16077 WP_003898583.1.16106 WP_003898583.1.16108 WP_003898583.1.16130 WP_003898583.1.16136 WP_003898583.1.16139 WP_003898583.1.16141 WP_003898583.1.16143 WP_003898583.1.1630 WP_003898583.1.16318 WP_003898583.1.1632 WP_003898583.1.16327 WP_003898583.1.16334 WP_003898583.1.16341 WP_003898583.1.16345 WP_003898583.1.16374 WP_003898583.1.16384 WP_003898583.1.16386 WP_003898583.1.164 WP_003898583.1.1642 WP_003898583.1.16424 WP_003898583.1.16431 WP_003898583.1.1644 WP_003898583.1.16442 WP_003898583.1.16448 WP_003898583.1.16451 WP_003898583.1.16476 WP_003898583.1.16480 WP_003898583.1.16494 WP_003898583.1.1652 WP_003898583.1.16549 WP_003898583.1.16560 WP_003898583.1.16598 WP_003898583.1.16609 WP_003898583.1.16619 WP_003898583.1.16620 WP_003898583.1.16622 WP_003898583.1.16637 WP_003898583.1.1669 WP_003898583.1.16707 WP_003898583.1.16724 WP_003898583.1.16731 WP_003898583.1.16743 WP_003898583.1.1683 WP_003898583.1.16852 WP_003898583.1.16937 WP_003898583.1.16940 WP_003898583.1.16950 WP_003898583.1.16959 WP_003898583.1.16968 WP_003898583.1.1697 WP_003898583.1.16977 WP_003898583.1.16987 WP_003898583.1.17005 WP_003898583.1.17006 WP_003898583.1.17010 WP_003898583.1.17015 WP_003898583.1.17019 WP_003898583.1.17041 WP_003898583.1.17052 WP_003898583.1.17057 WP_003898583.1.17062 WP_003898583.1.1707 WP_003898583.1.17094 WP_003898583.1.17130 WP_003898583.1.17138 WP_003898583.1.17147 WP_003898583.1.17224 WP_003898583.1.17251 WP_003898583.1.17288 WP_003898583.1.17304 WP_003898583.1.17345 WP_003898583.1.17381 WP_003898583.1.17391 WP_003898583.1.17412 WP_003898583.1.1743 WP_003898583.1.17440 WP_003898583.1.17466 WP_003898583.1.17477 WP_003898583.1.17483 WP_003898583.1.17505 WP_003898583.1.17527 WP_003898583.1.17535 WP_003898583.1.17540 WP_003898583.1.17553 WP_003898583.1.17558 WP_003898583.1.17599 WP_003898583.1.17635 WP_003898583.1.17655 WP_003898583.1.17679 WP_003898583.1.17687 WP_003898583.1.17700 WP_003898583.1.17710 WP_003898583.1.17713 WP_003898583.1.17722 WP_003898583.1.17746 WP_003898583.1.17788 WP_003898583.1.17798 WP_003898583.1.17803 WP_003898583.1.17816 WP_003898583.1.17821 WP_003898583.1.17830 WP_003898583.1.17868 WP_003898583.1.17878 WP_003898583.1.1792 WP_003898583.1.17923 WP_003898583.1.1795 WP_003898583.1.17955 WP_003898583.1.17973 WP_003898583.1.18009 WP_003898583.1.18033 WP_003898583.1.18057 WP_003898583.1.18065 WP_003898583.1.18070 WP_003898583.1.18116 WP_003898583.1.18120 WP_003898583.1.18126 WP_003898583.1.1817 WP_003898583.1.18170 WP_003898583.1.18206 WP_003898583.1.18216 WP_003898583.1.18240 WP_003898583.1.18257 WP_003898583.1.18297 WP_003898583.1.18306 WP_003898583.1.18364 WP_003898583.1.18399 WP_003898583.1.18411 WP_003898583.1.18444 WP_003898583.1.18448 WP_003898583.1.18467 WP_003898583.1.18476 WP_003898583.1.18522 WP_003898583.1.18580 WP_003898583.1.18582 WP_003898583.1.18587 WP_003898583.1.186 WP_003898583.1.18601 WP_003898583.1.18639 WP_003898583.1.18646 WP_003898583.1.18647 WP_003898583.1.1868 WP_003898583.1.18694 WP_003898583.1.18710 WP_003898583.1.18751 WP_003898583.1.18781 WP_003898583.1.18793 WP_003898583.1.18804 WP_003898583.1.18816 WP_003898583.1.18823 WP_003898583.1.18827 WP_003898583.1.18838 WP_003898583.1.18849 WP_003898583.1.18856 WP_003898583.1.18945 WP_003898583.1.1898 WP_003898583.1.19005 WP_003898583.1.19056 WP_003898583.1.19066 WP_003898583.1.19071 WP_003898583.1.19085 WP_003898583.1.19094 WP_003898583.1.19144 WP_003898583.1.19159 WP_003898583.1.19193 WP_003898583.1.19231 WP_003898583.1.19243 WP_003898583.1.19264 WP_003898583.1.19295 WP_003898583.1.19307 WP_003898583.1.19326 WP_003898583.1.1933 WP_003898583.1.19364 WP_003898583.1.19382 WP_003898583.1.19400 WP_003898583.1.19426 WP_003898583.1.19429 WP_003898583.1.19464 WP_003898583.1.19480 WP_003898583.1.19553 WP_003898583.1.19562 WP_003898583.1.19564 WP_003898583.1.19568 WP_003898583.1.19572 WP_003898583.1.19595 WP_003898583.1.19596 WP_003898583.1.19600 WP_003898583.1.19630 WP_003898583.1.1967 WP_003898583.1.19694 WP_003898583.1.1970 WP_003898583.1.19707 WP_003898583.1.19742 WP_003898583.1.19785 WP_003898583.1.19820 WP_003898583.1.19868 WP_003898583.1.19874 WP_003898583.1.19890 WP_003898583.1.19900 WP_003898583.1.19922 WP_003898583.1.19936 WP_003898583.1.19946 WP_003898583.1.19949 WP_003898583.1.19960 WP_003898583.1.19964 WP_003898583.1.20007 WP_003898583.1.20016 WP_003898583.1.2003 WP_003898583.1.20037 WP_003898583.1.20039 WP_003898583.1.20082 WP_003898583.1.20085 WP_003898583.1.20097 WP_003898583.1.20116 WP_003898583.1.20130 WP_003898583.1.20141 WP_003898583.1.20142 WP_003898583.1.20158 WP_003898583.1.20239 WP_003898583.1.20243 WP_003898583.1.20259 WP_003898583.1.20262 WP_003898583.1.20272 WP_003898583.1.20280 WP_003898583.1.20294 WP_003898583.1.20300 WP_003898583.1.20309 WP_003898583.1.20322 WP_003898583.1.2037 WP_003898583.1.20372 WP_003898583.1.20381 WP_003898583.1.204 WP_003898583.1.20427 WP_003898583.1.20457 WP_003898583.1.20459 WP_003898583.1.20460 WP_003898583.1.20542 WP_003898583.1.20578 WP_003898583.1.20608 WP_003898583.1.20624 WP_003898583.1.20628 WP_003898583.1.2066 WP_003898583.1.20707 WP_003898583.1.20722 WP_003898583.1.20729 WP_003898583.1.20742 WP_003898583.1.20751 WP_003898583.1.20776 WP_003898583.1.20843 WP_003898583.1.20850 WP_003898583.1.2086 WP_003898583.1.20868 WP_003898583.1.20876 WP_003898583.1.20897 WP_003898583.1.20898 WP_003898583.1.2090 WP_003898583.1.20911 WP_003898583.1.20921 WP_003898583.1.20926 WP_003898583.1.20927 WP_003898583.1.20951 WP_003898583.1.20970 WP_003898583.1.2104 WP_003898583.1.21127 WP_003898583.1.21135 WP_003898583.1.21173 WP_003898583.1.21187 WP_003898583.1.212 WP_003898583.1.2120 WP_003898583.1.21218 WP_003898583.1.21219 WP_003898583.1.2123 WP_003898583.1.21231 WP_003898583.1.21234 WP_003898583.1.2126 WP_003898583.1.21292 WP_003898583.1.21307 WP_003898583.1.2131 WP_003898583.1.21311 WP_003898583.1.21321 WP_003898583.1.21365 WP_003898583.1.21392 WP_003898583.1.21397 WP_003898583.1.21403 WP_003898583.1.21415 WP_003898583.1.21418 WP_003898583.1.21430 WP_003898583.1.21434 WP_003898583.1.21444 WP_003898583.1.21468 WP_003898583.1.21498 WP_003898583.1.21509 WP_003898583.1.21513 WP_003898583.1.21560 WP_003898583.1.21565 WP_003898583.1.21586 WP_003898583.1.21591 WP_003898583.1.21594 WP_003898583.1.21602 WP_003898583.1.21615 WP_003898583.1.21638 WP_003898583.1.21639 WP_003898583.1.21655 WP_003898583.1.21658 WP_003898583.1.2168 WP_003898583.1.2174 WP_003898583.1.21777 WP_003898583.1.21786 WP_003898583.1.21795 WP_003898583.1.218 WP_003898583.1.21826 WP_003898583.1.21829 WP_003898583.1.21840 WP_003898583.1.21843 WP_003898583.1.21872 WP_003898583.1.21873 WP_003898583.1.2188 WP_003898583.1.21882 WP_003898583.1.21906 WP_003898583.1.21912 WP_003898583.1.2194 WP_003898583.1.21941 WP_003898583.1.21956 WP_003898583.1.21958 WP_003898583.1.21960 WP_003898583.1.21971 WP_003898583.1.21973 WP_003898583.1.21983 WP_003898583.1.22003 WP_003898583.1.22013 WP_003898583.1.22025 WP_003898583.1.22036 WP_003898583.1.22075 WP_003898583.1.22092 WP_003898583.1.2212 WP_003898583.1.22127 WP_003898583.1.22140 WP_003898583.1.22233 WP_003898583.1.22255 WP_003898583.1.22277 WP_003898583.1.22348 WP_003898583.1.22366 WP_003898583.1.2238 WP_003898583.1.22380 WP_003898583.1.22437 WP_003898583.1.22438 WP_003898583.1.22511 WP_003898583.1.22524 WP_003898583.1.22585 WP_003898583.1.22606 WP_003898583.1.22608 WP_003898583.1.22609 WP_003898583.1.22618 WP_003898583.1.2262 WP_003898583.1.22624 WP_003898583.1.22629 WP_003898583.1.22647 WP_003898583.1.22664 WP_003898583.1.22665 WP_003898583.1.22670 WP_003898583.1.22725 WP_003898583.1.22728 WP_003898583.1.22733 WP_003898583.1.22737 WP_003898583.1.2275 WP_003898583.1.22754 WP_003898583.1.22800 WP_003898583.1.22804 WP_003898583.1.22829 WP_003898583.1.22840 WP_003898583.1.22844 WP_003898583.1.22970 WP_003898583.1.22996 WP_003898583.1.22997 WP_003898583.1.22999 WP_003898583.1.23015 WP_003898583.1.23032 WP_003898583.1.231 WP_003898583.1.23101 WP_003898583.1.2312 WP_003898583.1.23153 WP_003898583.1.23171 WP_003898583.1.23199 WP_003898583.1.2320 WP_003898583.1.23204 WP_003898583.1.23216 WP_003898583.1.23229 WP_003898583.1.23233 WP_003898583.1.2326 WP_003898583.1.23261 WP_003898583.1.23289 WP_003898583.1.2329 WP_003898583.1.23308 WP_003898583.1.23316 WP_003898583.1.23321 WP_003898583.1.2339 WP_003898583.1.23406 WP_003898583.1.23438 WP_003898583.1.23445 WP_003898583.1.23447 WP_003898583.1.23452 WP_003898583.1.23461 WP_003898583.1.2349 WP_003898583.1.23496 WP_003898583.1.23506 WP_003898583.1.23530 WP_003898583.1.23539 WP_003898583.1.23546 WP_003898583.1.23551 WP_003898583.1.23573 WP_003898583.1.23583 WP_003898583.1.23588 WP_003898583.1.23628 WP_003898583.1.23677 WP_003898583.1.23683 WP_003898583.1.23692 WP_003898583.1.23694 WP_003898583.1.23699 WP_003898583.1.2371 WP_003898583.1.23807 WP_003898583.1.23825 WP_003898583.1.23832 WP_003898583.1.2384 WP_003898583.1.23843 WP_003898583.1.23863 WP_003898583.1.23894 WP_003898583.1.23993 WP_003898583.1.2400 WP_003898583.1.24007 WP_003898583.1.24008 WP_003898583.1.24046 WP_003898583.1.24057 WP_003898583.1.24113 WP_003898583.1.24119 WP_003898583.1.24140 WP_003898583.1.24176 WP_003898583.1.24190 WP_003898583.1.24202 WP_003898583.1.24261 WP_003898583.1.24284 WP_003898583.1.24294 WP_003898583.1.24396 WP_003898583.1.24423 WP_003898583.1.2443 WP_003898583.1.24446 WP_003898583.1.24461 WP_003898583.1.24500 WP_003898583.1.24507 WP_003898583.1.24509 WP_003898583.1.24529 WP_003898583.1.24553 WP_003898583.1.24599 WP_003898583.1.24638 WP_003898583.1.24648 WP_003898583.1.2466 WP_003898583.1.24824 WP_003898583.1.24831 WP_003898583.1.24840 WP_003898583.1.24848 WP_003898583.1.24857 WP_003898583.1.2487 WP_003898583.1.24893 WP_003898583.1.24933 WP_003898583.1.24956 WP_003898583.1.24958 WP_003898583.1.24985 WP_003898583.1.2499 WP_003898583.1.25004 WP_003898583.1.2505 WP_003898583.1.25051 WP_003898583.1.2507 WP_003898583.1.25096 WP_003898583.1.25103 WP_003898583.1.25129 WP_003898583.1.25171 WP_003898583.1.25184 WP_003898583.1.25247 WP_003898583.1.25278 WP_003898583.1.25309 WP_003898583.1.25313 WP_003898583.1.25338 WP_003898583.1.25342 WP_003898583.1.25343 WP_003898583.1.25367 WP_003898583.1.25393 WP_003898583.1.25406 WP_003898583.1.25435 WP_003898583.1.25437 WP_003898583.1.25445 WP_003898583.1.25455 WP_003898583.1.25473 WP_003898583.1.25504 WP_003898583.1.25513 WP_003898583.1.25542 WP_003898583.1.25579 WP_003898583.1.25594 WP_003898583.1.25606 WP_003898583.1.25645 WP_003898583.1.2566 WP_003898583.1.25674 WP_003898583.1.25693 WP_003898583.1.25699 WP_003898583.1.25727 WP_003898583.1.25736 WP_003898583.1.25738 WP_003898583.1.25756 WP_003898583.1.25759 WP_003898583.1.2580 WP_003898583.1.25813 WP_003898583.1.25854 WP_003898583.1.25874 WP_003898583.1.25885 WP_003898583.1.25892 WP_003898583.1.25906 WP_003898583.1.25914 WP_003898583.1.25916 WP_003898583.1.2594 WP_003898583.1.25954 WP_003898583.1.25972 WP_003898583.1.26017 WP_003898583.1.26032 WP_003898583.1.26038 WP_003898583.1.26072 WP_003898583.1.26089 WP_003898583.1.26097 WP_003898583.1.26098 WP_003898583.1.26108 WP_003898583.1.26118 WP_003898583.1.26126 WP_003898583.1.2614 WP_003898583.1.26168 WP_003898583.1.26182 WP_003898583.1.26190 WP_003898583.1.2620 WP_003898583.1.26243 WP_003898583.1.26267 WP_003898583.1.26292 WP_003898583.1.26310 WP_003898583.1.26328 WP_003898583.1.26349 WP_003898583.1.26366 WP_003898583.1.26374 WP_003898583.1.26407 WP_003898583.1.26454 WP_003898583.1.26464 WP_003898583.1.2653 WP_003898583.1.26560 WP_003898583.1.26571 WP_003898583.1.2659 WP_003898583.1.26597 WP_003898583.1.26603 WP_003898583.1.26629 WP_003898583.1.26651 WP_003898583.1.26702 WP_003898583.1.26707 WP_003898583.1.26710 WP_003898583.1.26719 WP_003898583.1.26737 WP_003898583.1.26738 WP_003898583.1.26745 WP_003898583.1.26756 WP_003898583.1.2677 WP_003898583.1.26779 WP_003898583.1.26780 WP_003898583.1.26854 WP_003898583.1.26868 WP_003898583.1.26888 WP_003898583.1.26914 WP_003898583.1.26945 WP_003898583.1.26959 WP_003898583.1.26969 WP_003898583.1.26984 WP_003898583.1.26992 WP_003898583.1.27017 WP_003898583.1.27045 WP_003898583.1.27074 WP_003898583.1.27075 WP_003898583.1.27128 WP_003898583.1.27130 WP_003898583.1.27139 WP_003898583.1.27152 WP_003898583.1.27162 WP_003898583.1.27164 WP_003898583.1.27193 WP_003898583.1.27235 WP_003898583.1.27278 WP_003898583.1.27343 WP_003898583.1.27352 WP_003898583.1.27369 WP_003898583.1.27391 WP_003898583.1.27398 WP_003898583.1.27402 WP_003898583.1.27410 WP_003898583.1.27411 WP_003898583.1.27449 WP_003898583.1.27460 WP_003898583.1.27463 WP_003898583.1.2749 WP_003898583.1.27492 WP_003898583.1.27528 WP_003898583.1.27541 WP_003898583.1.27576 WP_003898583.1.27582 WP_003898583.1.27596 WP_003898583.1.27607 WP_003898583.1.2766 WP_003898583.1.277 WP_003898583.1.27724 WP_003898583.1.27730 WP_003898583.1.27736 WP_003898583.1.27743 WP_003898583.1.27750 WP_003898583.1.27771 WP_003898583.1.27779 WP_003898583.1.27795 WP_003898583.1.27819 WP_003898583.1.27835 WP_003898583.1.27915 WP_003898583.1.27935 WP_003898583.1.27962 WP_003898583.1.28053 WP_003898583.1.28092 WP_003898583.1.28106 WP_003898583.1.28131 WP_003898583.1.28142 WP_003898583.1.28159 WP_003898583.1.2816 WP_003898583.1.28161 WP_003898583.1.28192 WP_003898583.1.28202 WP_003898583.1.28241 WP_003898583.1.28242 WP_003898583.1.28251 WP_003898583.1.28255 WP_003898583.1.28269 WP_003898583.1.28276 WP_003898583.1.28293 WP_003898583.1.28331 WP_003898583.1.28367 WP_003898583.1.28378 WP_003898583.1.28391 WP_003898583.1.2842 WP_003898583.1.28448 WP_003898583.1.2847 WP_003898583.1.28471 WP_003898583.1.28473 WP_003898583.1.28493 WP_003898583.1.28497 WP_003898583.1.28530 WP_003898583.1.28545 WP_003898583.1.28561 WP_003898583.1.28567 WP_003898583.1.28585 WP_003898583.1.286 WP_003898583.1.28610 WP_003898583.1.28617 WP_003898583.1.28634 WP_003898583.1.28642 WP_003898583.1.28671 WP_003898583.1.28698 WP_003898583.1.28703 WP_003898583.1.28739 WP_003898583.1.28781 WP_003898583.1.28787 WP_003898583.1.28827 WP_003898583.1.28839 WP_003898583.1.28847 WP_003898583.1.28850 WP_003898583.1.28851 WP_003898583.1.28897 WP_003898583.1.28914 WP_003898583.1.28935 WP_003898583.1.28936 WP_003898583.1.28939 WP_003898583.1.28943 WP_003898583.1.28952 WP_003898583.1.28975 WP_003898583.1.2899 WP_003898583.1.28993 WP_003898583.1.29000 WP_003898583.1.2901 WP_003898583.1.29028 WP_003898583.1.29033 WP_003898583.1.29058 WP_003898583.1.29115 WP_003898583.1.2916 WP_003898583.1.29217 WP_003898583.1.29234 WP_003898583.1.29264 WP_003898583.1.29275 WP_003898583.1.29306 WP_003898583.1.29339 WP_003898583.1.29348 WP_003898583.1.29364 WP_003898583.1.29367 WP_003898583.1.2938 WP_003898583.1.29426 WP_003898583.1.2944 WP_003898583.1.29449 WP_003898583.1.29450 WP_003898583.1.29452 WP_003898583.1.29510 WP_003898583.1.29515 WP_003898583.1.29525 WP_003898583.1.2953 WP_003898583.1.29587 WP_003898583.1.2959 WP_003898583.1.29592 WP_003898583.1.29599 WP_003898583.1.29611 WP_003898583.1.29632 WP_003898583.1.29649 WP_003898583.1.2965 WP_003898583.1.29659 WP_003898583.1.2969 WP_003898583.1.29696 WP_003898583.1.29698 WP_003898583.1.29718 WP_003898583.1.29745 WP_003898583.1.29747 WP_003898583.1.29769 WP_003898583.1.29825 WP_003898583.1.29830 WP_003898583.1.29847 WP_003898583.1.29861 WP_003898583.1.29869 WP_003898583.1.29883 WP_003898583.1.29890 WP_003898583.1.299 WP_003898583.1.29931 WP_003898583.1.29960 WP_003898583.1.30014 WP_003898583.1.3004 WP_003898583.1.30040 WP_003898583.1.30043 WP_003898583.1.30074 WP_003898583.1.30097 WP_003898583.1.30106 WP_003898583.1.30114 WP_003898583.1.30126 WP_003898583.1.30131 WP_003898583.1.30138 WP_003898583.1.30139 WP_003898583.1.30145 WP_003898583.1.30235 WP_003898583.1.30237 WP_003898583.1.3027 WP_003898583.1.30279 WP_003898583.1.30282 WP_003898583.1.30288 WP_003898583.1.30291 WP_003898583.1.30363 WP_003898583.1.30374 WP_003898583.1.30404 WP_003898583.1.30433 WP_003898583.1.30438 WP_003898583.1.30462 WP_003898583.1.30464 WP_003898583.1.30468 WP_003898583.1.30500 WP_003898583.1.3057 WP_003898583.1.30574 WP_003898583.1.30628 WP_003898583.1.30641 WP_003898583.1.30642 WP_003898583.1.30661 WP_003898583.1.30683 WP_003898583.1.30699 WP_003898583.1.30709 WP_003898583.1.30713 WP_003898583.1.30716 WP_003898583.1.30719 WP_003898583.1.30730 WP_003898583.1.30736 WP_003898583.1.30760 WP_003898583.1.30791 WP_003898583.1.308 WP_003898583.1.30807 WP_003898583.1.30818 WP_003898583.1.30824 WP_003898583.1.30848 WP_003898583.1.30877 WP_003898583.1.30888 WP_003898583.1.30901 WP_003898583.1.30903 WP_003898583.1.30912 WP_003898583.1.30913 WP_003898583.1.30914 WP_003898583.1.30919 WP_003898583.1.30977 WP_003898583.1.3100 WP_003898583.1.31002 WP_003898583.1.3101 WP_003898583.1.31034 WP_003898583.1.31047 WP_003898583.1.31070 WP_003898583.1.31074 WP_003898583.1.31102 WP_003898583.1.31127 WP_003898583.1.31184 WP_003898583.1.31199 WP_003898583.1.31226 WP_003898583.1.31230 WP_003898583.1.31233 WP_003898583.1.31263 WP_003898583.1.31264 WP_003898583.1.31270 WP_003898583.1.31287 WP_003898583.1.31290 WP_003898583.1.31304 WP_003898583.1.31346 WP_003898583.1.31348 WP_003898583.1.31354 WP_003898583.1.31390 WP_003898583.1.31414 WP_003898583.1.31417 WP_003898583.1.31428 WP_003898583.1.3143 WP_003898583.1.31458 WP_003898583.1.31483 WP_003898583.1.3149 WP_003898583.1.31498 WP_003898583.1.31507 WP_003898583.1.31537 WP_003898583.1.31548 WP_003898583.1.31569 WP_003898583.1.31573 WP_003898583.1.316 WP_003898583.1.31629 WP_003898583.1.31666 WP_003898583.1.31693 WP_003898583.1.31703 WP_003898583.1.31744 WP_003898583.1.31745 WP_003898583.1.31770 WP_003898583.1.31776 WP_003898583.1.31783 WP_003898583.1.318 WP_003898583.1.3184 WP_003898583.1.31840 WP_003898583.1.31880 WP_003898583.1.31911 WP_003898583.1.31930 WP_003898583.1.31932 WP_003898583.1.31955 WP_003898583.1.31985 WP_003898583.1.31991 WP_003898583.1.31995 WP_003898583.1.32004 WP_003898583.1.32039 WP_003898583.1.3204 WP_003898583.1.32045 WP_003898583.1.32071 WP_003898583.1.32098 WP_003898583.1.32132 WP_003898583.1.32157 WP_003898583.1.32164 WP_003898583.1.32179 WP_003898583.1.32198 WP_003898583.1.32297 WP_003898583.1.32317 WP_003898583.1.32383 WP_003898583.1.32400 WP_003898583.1.32403 WP_003898583.1.32416 WP_003898583.1.32433 WP_003898583.1.32461 WP_003898583.1.32482 WP_003898583.1.32503 WP_003898583.1.32556 WP_003898583.1.32562 WP_003898583.1.32569 WP_003898583.1.32592 WP_003898583.1.32620 WP_003898583.1.32647 WP_003898583.1.32653 WP_003898583.1.32654 WP_003898583.1.3268 WP_003898583.1.32695 WP_003898583.1.32706 WP_003898583.1.32716 WP_003898583.1.32738 WP_003898583.1.32752 WP_003898583.1.32780 WP_003898583.1.32781 WP_003898583.1.32793 WP_003898583.1.32799 WP_003898583.1.32833 WP_003898583.1.32862 WP_003898583.1.32880 WP_003898583.1.32897 WP_003898583.1.32909 WP_003898583.1.32935 WP_003898583.1.32974 WP_003898583.1.33007 WP_003898583.1.3302 WP_003898583.1.33028 WP_003898583.1.33044 WP_003898583.1.33054 WP_003898583.1.33082 WP_003898583.1.33141 WP_003898583.1.33148 WP_003898583.1.33155 WP_003898583.1.3321 WP_003898583.1.33215 WP_003898583.1.3325 WP_003898583.1.3327 WP_003898583.1.33278 WP_003898583.1.33288 WP_003898583.1.33305 WP_003898583.1.3331 WP_003898583.1.33319 WP_003898583.1.3333 WP_003898583.1.33393 WP_003898583.1.33403 WP_003898583.1.33452 WP_003898583.1.33467 WP_003898583.1.33477 WP_003898583.1.3349 WP_003898583.1.33519 WP_003898583.1.33542 WP_003898583.1.33601 WP_003898583.1.33602 WP_003898583.1.33633 WP_003898583.1.33646 WP_003898583.1.33673 WP_003898583.1.3369 WP_003898583.1.33705 WP_003898583.1.33762 WP_003898583.1.33783 WP_003898583.1.33789 WP_003898583.1.3383 WP_003898583.1.33832 WP_003898583.1.33839 WP_003898583.1.33848 WP_003898583.1.3387 WP_003898583.1.33886 WP_003898583.1.33895 WP_003898583.1.33912 WP_003898583.1.33954 WP_003898583.1.34042 WP_003898583.1.3405 WP_003898583.1.34055 WP_003898583.1.34056 WP_003898583.1.34065 WP_003898583.1.3408 WP_003898583.1.34090 WP_003898583.1.34109 WP_003898583.1.34152 WP_003898583.1.34163 WP_003898583.1.34181 WP_003898583.1.34197 WP_003898583.1.34198 WP_003898583.1.34215 WP_003898583.1.34219 WP_003898583.1.34255 WP_003898583.1.34260 WP_003898583.1.34275 WP_003898583.1.343 WP_003898583.1.34347 WP_003898583.1.34392 WP_003898583.1.344 WP_003898583.1.34428 WP_003898583.1.3443 WP_003898583.1.34435 WP_003898583.1.34446 WP_003898583.1.34499 WP_003898583.1.34505 WP_003898583.1.34516 WP_003898583.1.34529 WP_003898583.1.34551 WP_003898583.1.34563 WP_003898583.1.34576 WP_003898583.1.34581 WP_003898583.1.34588 WP_003898583.1.34596 WP_003898583.1.34599 WP_003898583.1.34639 WP_003898583.1.34673 WP_003898583.1.34724 WP_003898583.1.34740 WP_003898583.1.34755 WP_003898583.1.34777 WP_003898583.1.34783 WP_003898583.1.34841 WP_003898583.1.34908 WP_003898583.1.34919 WP_003898583.1.3492 WP_003898583.1.34933 WP_003898583.1.34945 WP_003898583.1.34946 WP_003898583.1.34954 WP_003898583.1.34960 WP_003898583.1.34961 WP_003898583.1.34963 WP_003898583.1.34965 WP_003898583.1.34968 WP_003898583.1.35023 WP_003898583.1.35069 WP_003898583.1.35072 WP_003898583.1.35078 WP_003898583.1.35156 WP_003898583.1.35160 WP_003898583.1.35162 WP_003898583.1.35176 WP_003898583.1.3520 WP_003898583.1.35213 WP_003898583.1.35221 WP_003898583.1.35246 WP_003898583.1.35278 WP_003898583.1.35301 WP_003898583.1.35311 WP_003898583.1.35312 WP_003898583.1.35317 WP_003898583.1.35319 WP_003898583.1.35347 WP_003898583.1.35363 WP_003898583.1.35382 WP_003898583.1.35385 WP_003898583.1.35396 WP_003898583.1.35397 WP_003898583.1.35426 WP_003898583.1.35439 WP_003898583.1.35455 WP_003898583.1.3548 WP_003898583.1.35484 WP_003898583.1.35492 WP_003898583.1.3553 WP_003898583.1.35553 WP_003898583.1.35555 WP_003898583.1.35561 WP_003898583.1.35610 WP_003898583.1.35635 WP_003898583.1.35657 WP_003898583.1.35687 WP_003898583.1.35689 WP_003898583.1.35707 WP_003898583.1.35732 WP_003898583.1.35754 WP_003898583.1.35767 WP_003898583.1.35770 WP_003898583.1.35771 WP_003898583.1.35780 WP_003898583.1.35805 WP_003898583.1.35821 WP_003898583.1.3584 WP_003898583.1.35848 WP_003898583.1.35864 WP_003898583.1.35874 WP_003898583.1.35876 WP_003898583.1.35899 WP_003898583.1.35954 WP_003898583.1.36005 WP_003898583.1.36014 WP_003898583.1.36023 WP_003898583.1.36051 WP_003898583.1.36053 WP_003898583.1.36075 WP_003898583.1.36089 WP_003898583.1.36097 WP_003898583.1.36098 WP_003898583.1.36116 WP_003898583.1.36145 WP_003898583.1.36205 WP_003898583.1.36228 WP_003898583.1.36252 WP_003898583.1.36260 WP_003898583.1.36271 WP_003898583.1.36303 WP_003898583.1.36309 WP_003898583.1.36315 WP_003898583.1.36319 WP_003898583.1.36321 WP_003898583.1.36326 WP_003898583.1.3634 WP_003898583.1.36357 WP_003898583.1.3636 WP_003898583.1.36385 WP_003898583.1.36399 WP_003898583.1.36436 WP_003898583.1.36465 WP_003898583.1.36469 WP_003898583.1.36473 WP_003898583.1.36485 WP_003898583.1.36508 WP_003898583.1.36540 WP_003898583.1.36561 WP_003898583.1.36571 WP_003898583.1.36573 WP_003898583.1.36578 WP_003898583.1.36585 WP_003898583.1.36597 WP_003898583.1.36614 WP_003898583.1.36674 WP_003898583.1.36720 WP_003898583.1.36727 WP_003898583.1.36733 WP_003898583.1.36785 WP_003898583.1.36810 WP_003898583.1.36862 WP_003898583.1.36893 WP_003898583.1.36921 WP_003898583.1.36935 WP_003898583.1.36941 WP_003898583.1.3695 WP_003898583.1.36968 WP_003898583.1.3700 WP_003898583.1.37004 WP_003898583.1.37012 WP_003898583.1.37071 WP_003898583.1.37088 WP_003898583.1.37131 WP_003898583.1.37157 WP_003898583.1.37175 WP_003898583.1.37188 WP_003898583.1.37213 WP_003898583.1.37229 WP_003898583.1.3724 WP_003898583.1.37277 WP_003898583.1.37305 WP_003898583.1.37330 WP_003898583.1.37389 WP_003898583.1.37400 WP_003898583.1.37440 WP_003898583.1.37459 WP_003898583.1.37468 WP_003898583.1.37475 WP_003898583.1.37484 WP_003898583.1.37601 WP_003898583.1.37612 WP_003898583.1.37632 WP_003898583.1.37643 WP_003898583.1.37655 WP_003898583.1.37660 WP_003898583.1.37674 WP_003898583.1.37700 WP_003898583.1.37701 WP_003898583.1.37709 WP_003898583.1.37711 WP_003898583.1.37721 WP_003898583.1.37722 WP_003898583.1.37747 WP_003898583.1.37765 WP_003898583.1.37772 WP_003898583.1.37804 WP_003898583.1.37809 WP_003898583.1.37859 WP_003898583.1.37877 WP_003898583.1.37912 WP_003898583.1.37913 WP_003898583.1.37943 WP_003898583.1.37950 WP_003898583.1.37973 WP_003898583.1.37975 WP_003898583.1.37983 WP_003898583.1.38 WP_003898583.1.38002 WP_003898583.1.3802 WP_003898583.1.38039 WP_003898583.1.38040 WP_003898583.1.38067 WP_003898583.1.38068 WP_003898583.1.38138 WP_003898583.1.38144 WP_003898583.1.38158 WP_003898583.1.38159 WP_003898583.1.38210 WP_003898583.1.38233 WP_003898583.1.38240 WP_003898583.1.38299 WP_003898583.1.38332 WP_003898583.1.38347 WP_003898583.1.38354 WP_003898583.1.38389 WP_003898583.1.38398 WP_003898583.1.38402 WP_003898583.1.38418 WP_003898583.1.38421 WP_003898583.1.38466 WP_003898583.1.38477 WP_003898583.1.38483 WP_003898583.1.3849 WP_003898583.1.385 WP_003898583.1.38530 WP_003898583.1.38594 WP_003898583.1.38611 WP_003898583.1.38638 WP_003898583.1.38639 WP_003898583.1.38646 WP_003898583.1.38648 WP_003898583.1.38654 WP_003898583.1.38660 WP_003898583.1.38666 WP_003898583.1.38671 WP_003898583.1.38672 WP_003898583.1.38677 WP_003898583.1.38750 WP_003898583.1.38772 WP_003898583.1.38812 WP_003898583.1.38821 WP_003898583.1.38844 WP_003898583.1.38863 WP_003898583.1.38873 WP_003898583.1.3889 WP_003898583.1.38894 WP_003898583.1.38909 WP_003898583.1.38939 WP_003898583.1.38974 WP_003898583.1.38975 WP_003898583.1.38991 WP_003898583.1.39025 WP_003898583.1.39070 WP_003898583.1.39072 WP_003898583.1.39106 WP_003898583.1.39165 WP_003898583.1.39174 WP_003898583.1.39176 WP_003898583.1.39178 WP_003898583.1.39190 WP_003898583.1.39201 WP_003898583.1.39207 WP_003898583.1.39236 WP_003898583.1.39239 WP_003898583.1.39252 WP_003898583.1.39288 WP_003898583.1.39295 WP_003898583.1.39306 WP_003898583.1.39359 WP_003898583.1.39364 WP_003898583.1.39400 WP_003898583.1.39447 WP_003898583.1.3945 WP_003898583.1.39450 WP_003898583.1.39455 WP_003898583.1.39521 WP_003898583.1.39560 WP_003898583.1.39592 WP_003898583.1.39593 WP_003898583.1.396 WP_003898583.1.3960 WP_003898583.1.39616 WP_003898583.1.39654 WP_003898583.1.39657 WP_003898583.1.39661 WP_003898583.1.39674 WP_003898583.1.39678 WP_003898583.1.3968 WP_003898583.1.39694 WP_003898583.1.3971 WP_003898583.1.39718 WP_003898583.1.39728 WP_003898583.1.39739 WP_003898583.1.39748 WP_003898583.1.39751 WP_003898583.1.39759 WP_003898583.1.39801 WP_003898583.1.39804 WP_003898583.1.39848 WP_003898583.1.39877 WP_003898583.1.39925 WP_003898583.1.3994 WP_003898583.1.39959 WP_003898583.1.3996 WP_003898583.1.39960 WP_003898583.1.3997 WP_003898583.1.39980 WP_003898583.1.40000 WP_003898583.1.40028 WP_003898583.1.4003 WP_003898583.1.40094 WP_003898583.1.40096 WP_003898583.1.40150 WP_003898583.1.40156 WP_003898583.1.40174 WP_003898583.1.40186 WP_003898583.1.40276 WP_003898583.1.40277 WP_003898583.1.40323 WP_003898583.1.40336 WP_003898583.1.40353 WP_003898583.1.4036 WP_003898583.1.40372 WP_003898583.1.40402 WP_003898583.1.40413 WP_003898583.1.40440 WP_003898583.1.40446 WP_003898583.1.40451 WP_003898583.1.40455 WP_003898583.1.40523 WP_003898583.1.40641 WP_003898583.1.40646 WP_003898583.1.40651 WP_003898583.1.40653 WP_003898583.1.4067 WP_003898583.1.40705 WP_003898583.1.40723 WP_003898583.1.40731 WP_003898583.1.40735 WP_003898583.1.40795 WP_003898583.1.40799 WP_003898583.1.40876 WP_003898583.1.40881 WP_003898583.1.40922 WP_003898583.1.4095 WP_003898583.1.40956 WP_003898583.1.40957 WP_003898583.1.40964 WP_003898583.1.4097 WP_003898583.1.410 WP_003898583.1.41000 WP_003898583.1.41055 WP_003898583.1.41108 WP_003898583.1.41123 WP_003898583.1.41177 WP_003898583.1.41202 WP_003898583.1.41219 WP_003898583.1.41231 WP_003898583.1.41249 WP_003898583.1.4127 WP_003898583.1.41355 WP_003898583.1.41376 WP_003898583.1.41430 WP_003898583.1.41447 WP_003898583.1.41469 WP_003898583.1.41504 WP_003898583.1.41553 WP_003898583.1.41564 WP_003898583.1.41632 WP_003898583.1.41635 WP_003898583.1.41648 WP_003898583.1.41660 WP_003898583.1.41685 WP_003898583.1.41695 WP_003898583.1.41704 WP_003898583.1.4171 WP_003898583.1.41719 WP_003898583.1.41733 WP_003898583.1.41744 WP_003898583.1.41774 WP_003898583.1.41791 WP_003898583.1.41803 WP_003898583.1.41820 WP_003898583.1.41828 WP_003898583.1.41829 WP_003898583.1.41860 WP_003898583.1.41912 WP_003898583.1.41921 WP_003898583.1.41933 WP_003898583.1.41944 WP_003898583.1.42043 WP_003898583.1.42078 WP_003898583.1.42094 WP_003898583.1.42112 WP_003898583.1.4212 WP_003898583.1.42122 WP_003898583.1.42134 WP_003898583.1.42183 WP_003898583.1.42188 WP_003898583.1.42202 WP_003898583.1.42208 WP_003898583.1.42247 WP_003898583.1.42255 WP_003898583.1.42273 WP_003898583.1.42278 WP_003898583.1.42304 WP_003898583.1.42309 WP_003898583.1.42370 WP_003898583.1.42385 WP_003898583.1.42400 WP_003898583.1.42409 WP_003898583.1.42414 WP_003898583.1.42430 WP_003898583.1.42461 WP_003898583.1.42465 WP_003898583.1.42467 WP_003898583.1.42473 WP_003898583.1.42474 WP_003898583.1.4248 WP_003898583.1.42494 WP_003898583.1.42519 WP_003898583.1.42524 WP_003898583.1.42534 WP_003898583.1.4255 WP_003898583.1.42562 WP_003898583.1.42568 WP_003898583.1.42570 WP_003898583.1.42618 WP_003898583.1.42660 WP_003898583.1.42695 WP_003898583.1.42704 WP_003898583.1.42705 WP_003898583.1.42722 WP_003898583.1.42777 WP_003898583.1.42782 WP_003898583.1.42835 WP_003898583.1.42839 WP_003898583.1.42842 WP_003898583.1.42905 WP_003898583.1.42916 WP_003898583.1.42930 WP_003898583.1.42971 WP_003898583.1.43005 WP_003898583.1.43009 WP_003898583.1.43053 WP_003898583.1.43082 WP_003898583.1.43087 WP_003898583.1.43098 WP_003898583.1.43208 WP_003898583.1.43236 WP_003898583.1.43246 WP_003898583.1.43255 WP_003898583.1.43266 WP_003898583.1.43269 WP_003898583.1.43273 WP_003898583.1.43296 WP_003898583.1.43306 WP_003898583.1.4335 WP_003898583.1.43368 WP_003898583.1.43395 WP_003898583.1.43457 WP_003898583.1.43462 WP_003898583.1.43475 WP_003898583.1.43478 WP_003898583.1.43484 WP_003898583.1.43557 WP_003898583.1.43578 WP_003898583.1.43588 WP_003898583.1.43643 WP_003898583.1.43664 WP_003898583.1.43684 WP_003898583.1.43686 WP_003898583.1.43706 WP_003898583.1.43716 WP_003898583.1.4377 WP_003898583.1.43781 WP_003898583.1.43794 WP_003898583.1.43815 WP_003898583.1.43846 WP_003898583.1.43861 WP_003898583.1.43863 WP_003898583.1.43866 WP_003898583.1.43885 WP_003898583.1.43897 WP_003898583.1.4390 WP_003898583.1.43902 WP_003898583.1.43921 WP_003898583.1.43936 WP_003898583.1.43937 WP_003898583.1.43960 WP_003898583.1.43965 WP_003898583.1.4399 WP_003898583.1.43993 WP_003898583.1.43996 WP_003898583.1.44 WP_003898583.1.44001 WP_003898583.1.44008 WP_003898583.1.44033 WP_003898583.1.44037 WP_003898583.1.44070 WP_003898583.1.44071 WP_003898583.1.44076 WP_003898583.1.44104 WP_003898583.1.44111 WP_003898583.1.44124 WP_003898583.1.44169 WP_003898583.1.44219 WP_003898583.1.44237 WP_003898583.1.44277 WP_003898583.1.44279 WP_003898583.1.44336 WP_003898583.1.44355 WP_003898583.1.44358 WP_003898583.1.4438 WP_003898583.1.44390 WP_003898583.1.44392 WP_003898583.1.4441 WP_003898583.1.44415 WP_003898583.1.44466 WP_003898583.1.44489 WP_003898583.1.44492 WP_003898583.1.44494 WP_003898583.1.44500 WP_003898583.1.44532 WP_003898583.1.44534 WP_003898583.1.44562 WP_003898583.1.44597 WP_003898583.1.44600 WP_003898583.1.44602 WP_003898583.1.44615 WP_003898583.1.4464 WP_003898583.1.44651 WP_003898583.1.44659 WP_003898583.1.44665 WP_003898583.1.44694 WP_003898583.1.44700 WP_003898583.1.44713 WP_003898583.1.44735 WP_003898583.1.44740 WP_003898583.1.44757 WP_003898583.1.4476 WP_003898583.1.44761 WP_003898583.1.44776 WP_003898583.1.44779 WP_003898583.1.44786 WP_003898583.1.44808 WP_003898583.1.44864 WP_003898583.1.44901 WP_003898583.1.44908 WP_003898583.1.44913 WP_003898583.1.4492 WP_003898583.1.44939 WP_003898583.1.44979 WP_003898583.1.44981 WP_003898583.1.45002 WP_003898583.1.45011 WP_003898583.1.4504 WP_003898583.1.45081 WP_003898583.1.45113 WP_003898583.1.45129 WP_003898583.1.45135 WP_003898583.1.45147 WP_003898583.1.45168 WP_003898583.1.4517 WP_003898583.1.45181 WP_003898583.1.45185 WP_003898583.1.45192 WP_003898583.1.45200 WP_003898583.1.45205 WP_003898583.1.45211 WP_003898583.1.45249 WP_003898583.1.4526 WP_003898583.1.45286 WP_003898583.1.45326 WP_003898583.1.45347 WP_003898583.1.45374 WP_003898583.1.45390 WP_003898583.1.454 WP_003898583.1.45407 WP_003898583.1.45451 WP_003898583.1.45453 WP_003898583.1.45460 WP_003898583.1.45463 WP_003898583.1.45470 WP_003898583.1.45474 WP_003898583.1.45491 WP_003898583.1.45510 WP_003898583.1.45563 WP_003898583.1.45584 WP_003898583.1.45590 WP_003898583.1.45619 WP_003898583.1.45626 WP_003898583.1.45631 WP_003898583.1.45666 WP_003898583.1.45697 WP_003898583.1.4571 WP_003898583.1.45731 WP_003898583.1.45743 WP_003898583.1.45765 WP_003898583.1.45776 WP_003898583.1.45805 WP_003898583.1.45815 WP_003898583.1.45849 WP_003898583.1.45867 WP_003898583.1.45923 WP_003898583.1.45926 WP_003898583.1.45963 WP_003898583.1.45992 WP_003898583.1.46025 WP_003898583.1.46083 WP_003898583.1.46090 WP_003898583.1.46092 WP_003898583.1.46100 WP_003898583.1.46101 WP_003898583.1.46103 WP_003898583.1.46107 WP_003898583.1.46127 WP_003898583.1.46128 WP_003898583.1.46129 WP_003898583.1.46141 WP_003898583.1.46150 WP_003898583.1.46201 WP_003898583.1.46226 WP_003898583.1.4624 WP_003898583.1.46253 WP_003898583.1.46268 WP_003898583.1.46285 WP_003898583.1.46300 WP_003898583.1.46313 WP_003898583.1.46336 WP_003898583.1.46365 WP_003898583.1.46370 WP_003898583.1.46381 WP_003898583.1.46411 WP_003898583.1.4644 WP_003898583.1.46442 WP_003898583.1.46453 WP_003898583.1.46478 WP_003898583.1.46492 WP_003898583.1.46521 WP_003898583.1.4653 WP_003898583.1.46532 WP_003898583.1.46539 WP_003898583.1.46568 WP_003898583.1.46585 WP_003898583.1.46609 WP_003898583.1.46613 WP_003898583.1.46625 WP_003898583.1.46642 WP_003898583.1.46647 WP_003898583.1.46724 WP_003898583.1.46758 WP_003898583.1.46773 WP_003898583.1.46777 WP_003898583.1.46786 WP_003898583.1.46792 WP_003898583.1.46847 WP_003898583.1.46851 WP_003898583.1.4687 WP_003898583.1.46936 WP_003898583.1.46980 WP_003898583.1.47011 WP_003898583.1.47066 WP_003898583.1.47077 WP_003898583.1.47083 WP_003898583.1.47106 WP_003898583.1.47142 WP_003898583.1.47147 WP_003898583.1.47166 WP_003898583.1.47178 WP_003898583.1.47179 WP_003898583.1.47194 WP_003898583.1.47207 WP_003898583.1.47210 WP_003898583.1.47261 WP_003898583.1.47262 WP_003898583.1.47402 WP_003898583.1.47423 WP_003898583.1.47467 WP_003898583.1.47502 WP_003898583.1.4751 WP_003898583.1.47511 WP_003898583.1.47537 WP_003898583.1.47540 WP_003898583.1.47568 WP_003898583.1.47572 WP_003898583.1.47588 WP_003898583.1.47636 WP_003898583.1.4764 WP_003898583.1.47653 WP_003898583.1.47679 WP_003898583.1.47681 WP_003898583.1.47690 WP_003898583.1.4771 WP_003898583.1.47717 WP_003898583.1.47743 WP_003898583.1.47754 WP_003898583.1.47773 WP_003898583.1.47776 WP_003898583.1.47780 WP_003898583.1.47805 WP_003898583.1.47832 WP_003898583.1.47847 WP_003898583.1.47858 WP_003898583.1.47868 WP_003898583.1.47893 WP_003898583.1.47899 WP_003898583.1.479 WP_003898583.1.47912 WP_003898583.1.47913 WP_003898583.1.47926 WP_003898583.1.4794 WP_003898583.1.47943 WP_003898583.1.47944 WP_003898583.1.47959 WP_003898583.1.47974 WP_003898583.1.47993 WP_003898583.1.48004 WP_003898583.1.48039 WP_003898583.1.48050 WP_003898583.1.48084 WP_003898583.1.48097 WP_003898583.1.48101 WP_003898583.1.4813 WP_003898583.1.48130 WP_003898583.1.48135 WP_003898583.1.48143 WP_003898583.1.48152 WP_003898583.1.48155 WP_003898583.1.48170 WP_003898583.1.48173 WP_003898583.1.48177 WP_003898583.1.48185 WP_003898583.1.48204 WP_003898583.1.48219 WP_003898583.1.4823 WP_003898583.1.48240 WP_003898583.1.48256 WP_003898583.1.48264 WP_003898583.1.48287 WP_003898583.1.48330 WP_003898583.1.48333 WP_003898583.1.48348 WP_003898583.1.48354 WP_003898583.1.48372 WP_003898583.1.48383 WP_003898583.1.48388 WP_003898583.1.48419 WP_003898583.1.48423 WP_003898583.1.48443 WP_003898583.1.48462 WP_003898583.1.48543 WP_003898583.1.48550 WP_003898583.1.48605 WP_003898583.1.48618 WP_003898583.1.4863 WP_003898583.1.48648 WP_003898583.1.48658 WP_003898583.1.48666 WP_003898583.1.48687 WP_003898583.1.48779 WP_003898583.1.4878 WP_003898583.1.48798 WP_003898583.1.48802 WP_003898583.1.48826 WP_003898583.1.48831 WP_003898583.1.48843 WP_003898583.1.48857 WP_003898583.1.4890 WP_003898583.1.48946 WP_003898583.1.48979 WP_003898583.1.49017 WP_003898583.1.49048 WP_003898583.1.49059 WP_003898583.1.4906 WP_003898583.1.4907 WP_003898583.1.49103 WP_003898583.1.49110 WP_003898583.1.4919 WP_003898583.1.49251 WP_003898583.1.49254 WP_003898583.1.49263 WP_003898583.1.49291 WP_003898583.1.49296 WP_003898583.1.49335 WP_003898583.1.49337 WP_003898583.1.49419 WP_003898583.1.49426 WP_003898583.1.49437 WP_003898583.1.49439 WP_003898583.1.49474 WP_003898583.1.49506 WP_003898583.1.49523 WP_003898583.1.49526 WP_003898583.1.49532 WP_003898583.1.4959 WP_003898583.1.49678 WP_003898583.1.49687 WP_003898583.1.49699 WP_003898583.1.49709 WP_003898583.1.4971 WP_003898583.1.4972 WP_003898583.1.49736 WP_003898583.1.49746 WP_003898583.1.49764 WP_003898583.1.49773 WP_003898583.1.49796 WP_003898583.1.49814 WP_003898583.1.49815 WP_003898583.1.49816 WP_003898583.1.49839 WP_003898583.1.49857 WP_003898583.1.49878 WP_003898583.1.49880 WP_003898583.1.49944 WP_003898583.1.4999 WP_003898583.1.49990 WP_003898583.1.50068 WP_003898583.1.50077 WP_003898583.1.5008 WP_003898583.1.50081 WP_003898583.1.50122 WP_003898583.1.50126 WP_003898583.1.50149 WP_003898583.1.50162 WP_003898583.1.5018 WP_003898583.1.50194 WP_003898583.1.50235 WP_003898583.1.50249 WP_003898583.1.50265 WP_003898583.1.50271 WP_003898583.1.50324 WP_003898583.1.50347 WP_003898583.1.50372 WP_003898583.1.50398 WP_003898583.1.50407 WP_003898583.1.50444 WP_003898583.1.50466 WP_003898583.1.50472 WP_003898583.1.5048 WP_003898583.1.50498 WP_003898583.1.5050 WP_003898583.1.50540 WP_003898583.1.50554 WP_003898583.1.50557 WP_003898583.1.50601 WP_003898583.1.50610 WP_003898583.1.50632 WP_003898583.1.50633 WP_003898583.1.50655 WP_003898583.1.50659 WP_003898583.1.50683 WP_003898583.1.50689 WP_003898583.1.50692 WP_003898583.1.50714 WP_003898583.1.50729 WP_003898583.1.50756 WP_003898583.1.50784 WP_003898583.1.50794 WP_003898583.1.50841 WP_003898583.1.50877 WP_003898583.1.5096 WP_003898583.1.50981 WP_003898583.1.50987 WP_003898583.1.51003 WP_003898583.1.51009 WP_003898583.1.51037 WP_003898583.1.51074 WP_003898583.1.51082 WP_003898583.1.51101 WP_003898583.1.51116 WP_003898583.1.51149 WP_003898583.1.51156 WP_003898583.1.51157 WP_003898583.1.51213 WP_003898583.1.51232 WP_003898583.1.51239 WP_003898583.1.51247 WP_003898583.1.51266 WP_003898583.1.51279 WP_003898583.1.51291 WP_003898583.1.51294 WP_003898583.1.51301 WP_003898583.1.51329 WP_003898583.1.51391 WP_003898583.1.51422 WP_003898583.1.51445 WP_003898583.1.51455 WP_003898583.1.51466 WP_003898583.1.51468 WP_003898583.1.51478 WP_003898583.1.51497 WP_003898583.1.51520 WP_003898583.1.51593 WP_003898583.1.51628 WP_003898583.1.5164 WP_003898583.1.51647 WP_003898583.1.51660 WP_003898583.1.51696 WP_003898583.1.51721 WP_003898583.1.51788 WP_003898583.1.51795 WP_003898583.1.51801 WP_003898583.1.51817 WP_003898583.1.51819 WP_003898583.1.51854 WP_003898583.1.51923 WP_003898583.1.51942 WP_003898583.1.51948 WP_003898583.1.51963 WP_003898583.1.51969 WP_003898583.1.52000 WP_003898583.1.52001 WP_003898583.1.52003 WP_003898583.1.52006 WP_003898583.1.52036 WP_003898583.1.52046 WP_003898583.1.52059 WP_003898583.1.52069 WP_003898583.1.52082 WP_003898583.1.52102 WP_003898583.1.52166 WP_003898583.1.52168 WP_003898583.1.52173 WP_003898583.1.52178 WP_003898583.1.52206 WP_003898583.1.52216 WP_003898583.1.52238 WP_003898583.1.52241 WP_003898583.1.52280 WP_003898583.1.52314 WP_003898583.1.52385 WP_003898583.1.52390 WP_003898583.1.524 WP_003898583.1.52460 WP_003898583.1.52485 WP_003898583.1.52486 WP_003898583.1.52504 WP_003898583.1.52522 WP_003898583.1.52531 WP_003898583.1.52533 WP_003898583.1.52545 WP_003898583.1.52553 WP_003898583.1.52563 WP_003898583.1.52564 WP_003898583.1.52574 WP_003898583.1.52641 WP_003898583.1.52673 WP_003898583.1.52674 WP_003898583.1.52708 WP_003898583.1.52713 WP_003898583.1.52761 WP_003898583.1.52778 WP_003898583.1.52797 WP_003898583.1.52818 WP_003898583.1.52872 WP_003898583.1.52873 WP_003898583.1.52891 WP_003898583.1.52892 WP_003898583.1.52909 WP_003898583.1.52970 WP_003898583.1.52998 WP_003898583.1.53053 WP_003898583.1.53056 WP_003898583.1.5306 WP_003898583.1.53088 WP_003898583.1.5309 WP_003898583.1.531 WP_003898583.1.53117 WP_003898583.1.53118 WP_003898583.1.53142 WP_003898583.1.53143 WP_003898583.1.53157 WP_003898583.1.53167 WP_003898583.1.53200 WP_003898583.1.53213 WP_003898583.1.53217 WP_003898583.1.53229 WP_003898583.1.53230 WP_003898583.1.53237 WP_003898583.1.53254 WP_003898583.1.53257 WP_003898583.1.5327 WP_003898583.1.53276 WP_003898583.1.53278 WP_003898583.1.533 WP_003898583.1.53306 WP_003898583.1.5334 WP_003898583.1.5335 WP_003898583.1.53353 WP_003898583.1.53381 WP_003898583.1.53413 WP_003898583.1.53458 WP_003898583.1.53460 WP_003898583.1.53480 WP_003898583.1.53517 WP_003898583.1.53522 WP_003898583.1.53525 WP_003898583.1.53526 WP_003898583.1.53553 WP_003898583.1.53606 WP_003898583.1.53628 WP_003898583.1.53643 WP_003898583.1.53667 WP_003898583.1.53679 WP_003898583.1.53715 WP_003898583.1.53730 WP_003898583.1.53742 WP_003898583.1.53743 WP_003898583.1.53754 WP_003898583.1.53775 WP_003898583.1.53787 WP_003898583.1.53803 WP_003898583.1.53818 WP_003898583.1.53853 WP_003898583.1.53865 WP_003898583.1.53888 WP_003898583.1.53900 WP_003898583.1.53912 WP_003898583.1.53914 WP_003898583.1.53952 WP_003898583.1.5398 WP_003898583.1.5408 WP_003898583.1.54089 WP_003898583.1.54093 WP_003898583.1.54099 WP_003898583.1.54112 WP_003898583.1.54125 WP_003898583.1.54141 WP_003898583.1.54162 WP_003898583.1.54179 WP_003898583.1.54206 WP_003898583.1.54218 WP_003898583.1.54225 WP_003898583.1.54227 WP_003898583.1.54232 WP_003898583.1.54241 WP_003898583.1.54245 WP_003898583.1.54247 WP_003898583.1.54260 WP_003898583.1.54275 WP_003898583.1.54280 WP_003898583.1.5429 WP_003898583.1.54294 WP_003898583.1.54314 WP_003898583.1.54351 WP_003898583.1.54370 WP_003898583.1.54428 WP_003898583.1.54449 WP_003898583.1.54494 WP_003898583.1.54514 WP_003898583.1.54519 WP_003898583.1.5452 WP_003898583.1.54531 WP_003898583.1.54537 WP_003898583.1.54555 WP_003898583.1.54575 WP_003898583.1.54633 WP_003898583.1.54686 WP_003898583.1.54687 WP_003898583.1.54705 WP_003898583.1.54730 WP_003898583.1.54732 WP_003898583.1.5475 WP_003898583.1.54797 WP_003898583.1.54807 WP_003898583.1.54836 WP_003898583.1.54838 WP_003898583.1.54860 WP_003898583.1.54888 WP_003898583.1.54897 WP_003898583.1.54905 WP_003898583.1.54909 WP_003898583.1.54937 WP_003898583.1.54939 WP_003898583.1.54944 WP_003898583.1.54945 WP_003898583.1.54953 WP_003898583.1.54964 WP_003898583.1.55015 WP_003898583.1.55022 WP_003898583.1.55023 WP_003898583.1.55051 WP_003898583.1.55072 WP_003898583.1.55088 WP_003898583.1.55106 WP_003898583.1.55126 WP_003898583.1.55128 WP_003898583.1.55140 WP_003898583.1.55150 WP_003898583.1.55210 WP_003898583.1.55227 WP_003898583.1.55248 WP_003898583.1.55257 WP_003898583.1.55258 WP_003898583.1.55267 WP_003898583.1.55279 WP_003898583.1.55307 WP_003898583.1.55326 WP_003898583.1.55328 WP_003898583.1.5533 WP_003898583.1.55345 WP_003898583.1.55396 WP_003898583.1.55398 WP_003898583.1.55441 WP_003898583.1.55459 WP_003898583.1.55501 WP_003898583.1.55578 WP_003898583.1.55626 WP_003898583.1.55641 WP_003898583.1.5569 WP_003898583.1.55723 WP_003898583.1.55735 WP_003898583.1.5574 WP_003898583.1.55772 WP_003898583.1.55802 WP_003898583.1.55819 WP_003898583.1.55821 WP_003898583.1.5583 WP_003898583.1.55849 WP_003898583.1.55856 WP_003898583.1.55860 WP_003898583.1.55882 WP_003898583.1.55883 WP_003898583.1.55894 WP_003898583.1.55902 WP_003898583.1.55908 WP_003898583.1.55909 WP_003898583.1.5591 WP_003898583.1.55961 WP_003898583.1.55977 WP_003898583.1.55983 WP_003898583.1.56028 WP_003898583.1.56057 WP_003898583.1.56060 WP_003898583.1.56107 WP_003898583.1.56132 WP_003898583.1.56163 WP_003898583.1.56167 WP_003898583.1.56178 WP_003898583.1.56287 WP_003898583.1.56292 WP_003898583.1.56327 WP_003898583.1.56341 WP_003898583.1.56359 WP_003898583.1.56365 WP_003898583.1.56394 WP_003898583.1.56443 WP_003898583.1.56473 WP_003898583.1.56478 WP_003898583.1.56500 WP_003898583.1.56517 WP_003898583.1.5656 WP_003898583.1.56577 WP_003898583.1.56593 WP_003898583.1.56625 WP_003898583.1.56637 WP_003898583.1.56670 WP_003898583.1.56697 WP_003898583.1.567 WP_003898583.1.56701 WP_003898583.1.56743 WP_003898583.1.56755 WP_003898583.1.56764 WP_003898583.1.56769 WP_003898583.1.56770 WP_003898583.1.56795 WP_003898583.1.5681 WP_003898583.1.56827 WP_003898583.1.56839 WP_003898583.1.56863 WP_003898583.1.56868 WP_003898583.1.56869 WP_003898583.1.56915 WP_003898583.1.56926 WP_003898583.1.56961 WP_003898583.1.56971 WP_003898583.1.56972 WP_003898583.1.57023 WP_003898583.1.57035 WP_003898583.1.57077 WP_003898583.1.57087 WP_003898583.1.57094 WP_003898583.1.57134 WP_003898583.1.57169 WP_003898583.1.57208 WP_003898583.1.57212 WP_003898583.1.57230 WP_003898583.1.5724 WP_003898583.1.5725 WP_003898583.1.5727 WP_003898583.1.57273 WP_003898583.1.573 WP_003898583.1.57326 WP_003898583.1.57328 WP_003898583.1.57331 WP_003898583.1.57340 WP_003898583.1.57351 WP_003898583.1.57380 WP_003898583.1.57430 WP_003898583.1.5744 WP_003898583.1.57440 WP_003898583.1.5745 WP_003898583.1.57461 WP_003898583.1.57469 WP_003898583.1.57489 WP_003898583.1.575 WP_003898583.1.57509 WP_003898583.1.57519 WP_003898583.1.57525 WP_003898583.1.57551 WP_003898583.1.57596 WP_003898583.1.57604 WP_003898583.1.57619 WP_003898583.1.57627 WP_003898583.1.57642 WP_003898583.1.57658 WP_003898583.1.57675 WP_003898583.1.57689 WP_003898583.1.57708 WP_003898583.1.57794 WP_003898583.1.57821 WP_003898583.1.57825 WP_003898583.1.57843 WP_003898583.1.57906 WP_003898583.1.57924 WP_003898583.1.57926 WP_003898583.1.57957 WP_003898583.1.57960 WP_003898583.1.57964 WP_003898583.1.57991 WP_003898583.1.58086 WP_003898583.1.58103 WP_003898583.1.58108 WP_003898583.1.5811 WP_003898583.1.58121 WP_003898583.1.58145 WP_003898583.1.58164 WP_003898583.1.58174 WP_003898583.1.582 WP_003898583.1.58209 WP_003898583.1.58215 WP_003898583.1.5824 WP_003898583.1.58259 WP_003898583.1.58283 WP_003898583.1.58288 WP_003898583.1.5830 WP_003898583.1.58303 WP_003898583.1.58311 WP_003898583.1.58330 WP_003898583.1.58359 WP_003898583.1.58386 WP_003898583.1.58393 WP_003898583.1.58431 WP_003898583.1.5844 WP_003898583.1.58457 WP_003898583.1.58488 WP_003898583.1.58518 WP_003898583.1.58534 WP_003898583.1.58559 WP_003898583.1.58567 WP_003898583.1.58573 WP_003898583.1.58602 WP_003898583.1.58612 WP_003898583.1.58619 WP_003898583.1.58630 WP_003898583.1.5865 WP_003898583.1.58671 WP_003898583.1.58690 WP_003898583.1.58702 WP_003898583.1.58743 WP_003898583.1.58754 WP_003898583.1.5879 WP_003898583.1.5881 WP_003898583.1.58824 WP_003898583.1.58848 WP_003898583.1.58857 WP_003898583.1.58891 WP_003898583.1.58892 WP_003898583.1.5890 WP_003898583.1.58904 WP_003898583.1.58921 WP_003898583.1.58930 WP_003898583.1.58953 WP_003898583.1.58961 WP_003898583.1.5898 WP_003898583.1.59025 WP_003898583.1.59029 WP_003898583.1.59037 WP_003898583.1.59044 WP_003898583.1.59085 WP_003898583.1.59088 WP_003898583.1.59112 WP_003898583.1.59130 WP_003898583.1.5914 WP_003898583.1.59147 WP_003898583.1.59166 WP_003898583.1.59205 WP_003898583.1.59209 WP_003898583.1.59237 WP_003898583.1.59240 WP_003898583.1.59253 WP_003898583.1.59254 WP_003898583.1.59262 WP_003898583.1.59270 WP_003898583.1.5928 WP_003898583.1.59304 WP_003898583.1.59305 WP_003898583.1.59309 WP_003898583.1.59326 WP_003898583.1.59328 WP_003898583.1.59333 WP_003898583.1.59338 WP_003898583.1.59428 WP_003898583.1.59487 WP_003898583.1.59537 WP_003898583.1.59561 WP_003898583.1.59677 WP_003898583.1.59722 WP_003898583.1.59727 WP_003898583.1.59732 WP_003898583.1.59738 WP_003898583.1.59750 WP_003898583.1.59757 WP_003898583.1.59761 WP_003898583.1.59808 WP_003898583.1.59850 WP_003898583.1.59860 WP_003898583.1.59861 WP_003898583.1.5987 WP_003898583.1.59878 WP_003898583.1.59888 WP_003898583.1.59952 WP_003898583.1.5996 WP_003898583.1.59961 WP_003898583.1.59974 WP_003898583.1.6000 WP_003898583.1.6003 WP_003898583.1.60047 WP_003898583.1.6007 WP_003898583.1.60121 WP_003898583.1.60125 WP_003898583.1.60135 WP_003898583.1.60139 WP_003898583.1.60152 WP_003898583.1.60171 WP_003898583.1.60197 WP_003898583.1.6020 WP_003898583.1.60205 WP_003898583.1.60207 WP_003898583.1.60215 WP_003898583.1.60217 WP_003898583.1.60267 WP_003898583.1.60288 WP_003898583.1.60291 WP_003898583.1.60301 WP_003898583.1.60305 WP_003898583.1.60312 WP_003898583.1.60313 WP_003898583.1.60314 WP_003898583.1.60367 WP_003898583.1.60376 WP_003898583.1.60403 WP_003898583.1.60413 WP_003898583.1.60421 WP_003898583.1.60451 WP_003898583.1.60460 WP_003898583.1.60487 WP_003898583.1.60512 WP_003898583.1.60573 WP_003898583.1.60583 WP_003898583.1.60632 WP_003898583.1.60657 WP_003898583.1.60687 WP_003898583.1.60689 WP_003898583.1.60727 WP_003898583.1.60738 WP_003898583.1.60763 WP_003898583.1.6077 WP_003898583.1.60791 WP_003898583.1.60834 WP_003898583.1.60878 WP_003898583.1.60879 WP_003898583.1.60913 WP_003898583.1.60978 WP_003898583.1.61000 WP_003898583.1.61001 WP_003898583.1.61012 WP_003898583.1.61014 WP_003898583.1.61015 WP_003898583.1.61037 WP_003898583.1.61052 WP_003898583.1.61065 WP_003898583.1.61100 WP_003898583.1.61101 WP_003898583.1.61138 WP_003898583.1.61142 WP_003898583.1.61198 WP_003898583.1.61234 WP_003898583.1.61281 WP_003898583.1.61314 WP_003898583.1.61321 WP_003898583.1.61326 WP_003898583.1.61328 WP_003898583.1.61368 WP_003898583.1.61391 WP_003898583.1.61406 WP_003898583.1.61409 WP_003898583.1.61420 WP_003898583.1.61422 WP_003898583.1.61425 WP_003898583.1.61428 WP_003898583.1.61469 WP_003898583.1.61522 WP_003898583.1.61552 WP_003898583.1.61557 WP_003898583.1.61567 WP_003898583.1.61571 WP_003898583.1.61573 WP_003898583.1.61584 WP_003898583.1.61586 WP_003898583.1.6159 WP_003898583.1.61592 WP_003898583.1.6160 WP_003898583.1.61614 WP_003898583.1.6163 WP_003898583.1.61655 WP_003898583.1.61665 WP_003898583.1.61669 WP_003898583.1.61682 WP_003898583.1.61692 WP_003898583.1.61719 WP_003898583.1.61728 WP_003898583.1.61750 WP_003898583.1.61754 WP_003898583.1.61755 WP_003898583.1.61757 WP_003898583.1.6179 WP_003898583.1.61816 WP_003898583.1.61842 WP_003898583.1.61850 WP_003898583.1.61862 WP_003898583.1.61865 WP_003898583.1.61868 WP_003898583.1.61911 WP_003898583.1.61941 WP_003898583.1.61953 WP_003898583.1.61986 WP_003898583.1.61987 WP_003898583.1.61998 WP_003898583.1.62021 WP_003898583.1.62087 WP_003898583.1.62089 WP_003898583.1.62101 WP_003898583.1.62104 WP_003898583.1.6211 WP_003898583.1.62132 WP_003898583.1.62162 WP_003898583.1.62225 WP_003898583.1.62230 WP_003898583.1.62238 WP_003898583.1.62249 WP_003898583.1.62270 WP_003898583.1.62281 WP_003898583.1.62307 WP_003898583.1.6231 WP_003898583.1.62359 WP_003898583.1.62371 WP_003898583.1.62379 WP_003898583.1.62395 WP_003898583.1.62449 WP_003898583.1.62468 WP_003898583.1.6248 WP_003898583.1.62508 WP_003898583.1.62565 WP_003898583.1.62594 WP_003898583.1.62606 WP_003898583.1.62616 WP_003898583.1.62666 WP_003898583.1.62687 WP_003898583.1.62715 WP_003898583.1.62730 WP_003898583.1.62738 WP_003898583.1.62761 WP_003898583.1.62766 WP_003898583.1.62813 WP_003898583.1.62839 WP_003898583.1.62841 WP_003898583.1.62909 WP_003898583.1.62936 WP_003898583.1.6294 WP_003898583.1.6295 WP_003898583.1.62962 WP_003898583.1.63007 WP_003898583.1.63019 WP_003898583.1.63032 WP_003898583.1.63037 WP_003898583.1.63064 WP_003898583.1.63066 WP_003898583.1.63072 WP_003898583.1.6308 WP_003898583.1.63081 WP_003898583.1.63096 WP_003898583.1.63106 WP_003898583.1.63144 WP_003898583.1.63160 WP_003898583.1.63161 WP_003898583.1.63175 WP_003898583.1.63194 WP_003898583.1.63222 WP_003898583.1.6328 WP_003898583.1.63291 WP_003898583.1.63312 WP_003898583.1.63317 WP_003898583.1.63331 WP_003898583.1.63373 WP_003898583.1.63384 WP_003898583.1.63403 WP_003898583.1.63424 WP_003898583.1.63428 WP_003898583.1.6345 WP_003898583.1.63464 WP_003898583.1.63483 WP_003898583.1.63502 WP_003898583.1.63504 WP_003898583.1.63522 WP_003898583.1.63530 WP_003898583.1.63564 WP_003898583.1.63567 WP_003898583.1.63596 WP_003898583.1.63600 WP_003898583.1.63623 WP_003898583.1.63624 WP_003898583.1.63625 WP_003898583.1.63627 WP_003898583.1.63654 WP_003898583.1.63662 WP_003898583.1.63711 WP_003898583.1.63734 WP_003898583.1.63807 WP_003898583.1.63819 WP_003898583.1.63844 WP_003898583.1.63888 WP_003898583.1.63913 WP_003898583.1.63915 WP_003898583.1.63918 WP_003898583.1.63970 WP_003898583.1.64000 WP_003898583.1.64027 WP_003898583.1.64058 WP_003898583.1.64065 WP_003898583.1.6407 WP_003898583.1.64082 WP_003898583.1.64091 WP_003898583.1.64102 WP_003898583.1.64104 WP_003898583.1.64169 WP_003898583.1.64219 WP_003898583.1.6422 WP_003898583.1.64222 WP_003898583.1.64228 WP_003898583.1.64235 WP_003898583.1.64249 WP_003898583.1.6427 WP_003898583.1.64278 WP_003898583.1.64287 WP_003898583.1.64414 WP_003898583.1.64419 WP_003898583.1.6443 WP_003898583.1.64463 WP_003898583.1.64480 WP_003898583.1.64497 WP_003898583.1.64506 WP_003898583.1.64511 WP_003898583.1.64513 WP_003898583.1.64515 WP_003898583.1.64522 WP_003898583.1.64543 WP_003898583.1.6456 WP_003898583.1.64567 WP_003898583.1.64588 WP_003898583.1.64589 WP_003898583.1.64594 WP_003898583.1.64595 WP_003898583.1.64608 WP_003898583.1.64619 WP_003898583.1.64629 WP_003898583.1.6464 WP_003898583.1.64664 WP_003898583.1.64669 WP_003898583.1.64672 WP_003898583.1.64680 WP_003898583.1.64682 WP_003898583.1.64727 WP_003898583.1.64729 WP_003898583.1.64774 WP_003898583.1.64776 WP_003898583.1.64832 WP_003898583.1.6486 WP_003898583.1.64870 WP_003898583.1.64898 WP_003898583.1.64922 WP_003898583.1.64924 WP_003898583.1.6493 WP_003898583.1.64941 WP_003898583.1.64973 WP_003898583.1.65001 WP_003898583.1.65026 WP_003898583.1.65053 WP_003898583.1.65070 WP_003898583.1.65079 WP_003898583.1.65102 WP_003898583.1.65157 WP_003898583.1.65181 WP_003898583.1.65212 WP_003898583.1.65229 WP_003898583.1.6523 WP_003898583.1.65253 WP_003898583.1.65289 WP_003898583.1.65291 WP_003898583.1.65315 WP_003898583.1.65329 WP_003898583.1.65359 WP_003898583.1.6536 WP_003898583.1.65374 WP_003898583.1.65386 WP_003898583.1.65414 WP_003898583.1.65416 WP_003898583.1.65433 WP_003898583.1.65455 WP_003898583.1.65467 WP_003898583.1.65488 WP_003898583.1.65529 WP_003898583.1.65539 WP_003898583.1.65583 WP_003898583.1.65612 WP_003898583.1.65623 WP_003898583.1.65635 WP_003898583.1.65637 WP_003898583.1.65648 WP_003898583.1.65683 WP_003898583.1.65686 WP_003898583.1.65688 WP_003898583.1.65707 WP_003898583.1.65733 WP_003898583.1.65746 WP_003898583.1.65747 WP_003898583.1.65759 WP_003898583.1.65816 WP_003898583.1.65830 WP_003898583.1.65858 WP_003898583.1.65862 WP_003898583.1.65869 WP_003898583.1.65893 WP_003898583.1.65929 WP_003898583.1.65932 WP_003898583.1.65958 WP_003898583.1.65974 WP_003898583.1.66004 WP_003898583.1.6606 WP_003898583.1.66089 WP_003898583.1.66149 WP_003898583.1.66151 WP_003898583.1.66276 WP_003898583.1.66293 WP_003898583.1.66297 WP_003898583.1.66323 WP_003898583.1.66325 WP_003898583.1.6633 WP_003898583.1.66334 WP_003898583.1.66355 WP_003898583.1.66367 WP_003898583.1.66394 WP_003898583.1.66396 WP_003898583.1.66451 WP_003898583.1.66455 WP_003898583.1.66457 WP_003898583.1.66464 WP_003898583.1.66466 WP_003898583.1.66487 WP_003898583.1.66504 WP_003898583.1.66544 WP_003898583.1.66558 WP_003898583.1.66580 WP_003898583.1.66582 WP_003898583.1.66612 WP_003898583.1.66617 WP_003898583.1.66635 WP_003898583.1.66656 WP_003898583.1.66663 WP_003898583.1.66675 WP_003898583.1.66715 WP_003898583.1.66718 WP_003898583.1.66762 WP_003898583.1.66776 WP_003898583.1.66808 WP_003898583.1.66817 WP_003898583.1.66819 WP_003898583.1.66826 WP_003898583.1.66830 WP_003898583.1.66842 WP_003898583.1.66868 WP_003898583.1.66878 WP_003898583.1.66880 WP_003898583.1.66893 WP_003898583.1.66961 WP_003898583.1.67005 WP_003898583.1.6704 WP_003898583.1.67044 WP_003898583.1.67061 WP_003898583.1.67098 WP_003898583.1.67146 WP_003898583.1.67197 WP_003898583.1.67198 WP_003898583.1.6720 WP_003898583.1.67207 WP_003898583.1.67218 WP_003898583.1.67220 WP_003898583.1.67225 WP_003898583.1.67231 WP_003898583.1.6724 WP_003898583.1.67257 WP_003898583.1.67298 WP_003898583.1.67307 WP_003898583.1.67324 WP_003898583.1.67332 WP_003898583.1.67346 WP_003898583.1.67360 WP_003898583.1.67381 WP_003898583.1.67396 WP_003898583.1.67417 WP_003898583.1.67422 WP_003898583.1.67453 WP_003898583.1.67459 WP_003898583.1.6746 WP_003898583.1.67473 WP_003898583.1.67482 WP_003898583.1.67496 WP_003898583.1.67499 WP_003898583.1.67523 WP_003898583.1.67536 WP_003898583.1.67575 WP_003898583.1.67587 WP_003898583.1.67598 WP_003898583.1.67600 WP_003898583.1.67602 WP_003898583.1.67630 WP_003898583.1.67679 WP_003898583.1.67692 WP_003898583.1.67744 WP_003898583.1.6775 WP_003898583.1.6777 WP_003898583.1.67809 WP_003898583.1.67816 WP_003898583.1.67844 WP_003898583.1.67848 WP_003898583.1.67870 WP_003898583.1.67888 WP_003898583.1.67915 WP_003898583.1.67945 WP_003898583.1.67949 WP_003898583.1.67980 WP_003898583.1.67982 WP_003898583.1.68022 WP_003898583.1.68029 WP_003898583.1.68037 WP_003898583.1.68038 WP_003898583.1.68045 WP_003898583.1.68057 WP_003898583.1.68083 WP_003898583.1.68088 WP_003898583.1.68106 WP_003898583.1.68110 WP_003898583.1.68153 WP_003898583.1.68169 WP_003898583.1.68193 WP_003898583.1.68212 WP_003898583.1.68227 WP_003898583.1.68243 WP_003898583.1.6825 WP_003898583.1.68297 WP_003898583.1.68309 WP_003898583.1.68325 WP_003898583.1.68329 WP_003898583.1.68340 WP_003898583.1.68384 WP_003898583.1.68388 WP_003898583.1.68429 WP_003898583.1.6843 WP_003898583.1.68433 WP_003898583.1.68444 WP_003898583.1.68465 WP_003898583.1.68518 WP_003898583.1.68569 WP_003898583.1.68576 WP_003898583.1.68580 WP_003898583.1.68586 WP_003898583.1.68623 WP_003898583.1.68637 WP_003898583.1.68646 WP_003898583.1.68667 WP_003898583.1.68669 WP_003898583.1.68672 WP_003898583.1.68684 WP_003898583.1.68704 WP_003898583.1.68708 WP_003898583.1.6872 WP_003898583.1.68730 WP_003898583.1.68734 WP_003898583.1.68748 WP_003898583.1.68754 WP_003898583.1.6876 WP_003898583.1.68761 WP_003898583.1.68763 WP_003898583.1.68766 WP_003898583.1.68774 WP_003898583.1.68796 WP_003898583.1.68824 WP_003898583.1.68832 WP_003898583.1.68833 WP_003898583.1.68841 WP_003898583.1.68859 WP_003898583.1.68876 WP_003898583.1.68906 WP_003898583.1.68916 WP_003898583.1.68923 WP_003898583.1.68945 WP_003898583.1.6896 WP_003898583.1.68981 WP_003898583.1.68984 WP_003898583.1.68997 WP_003898583.1.69076 WP_003898583.1.69079 WP_003898583.1.6908 WP_003898583.1.69082 WP_003898583.1.69178 WP_003898583.1.69208 WP_003898583.1.69231 WP_003898583.1.69256 WP_003898583.1.69311 WP_003898583.1.69315 WP_003898583.1.69322 WP_003898583.1.69342 WP_003898583.1.6936 WP_003898583.1.69369 WP_003898583.1.69374 WP_003898583.1.69398 WP_003898583.1.69401 WP_003898583.1.69426 WP_003898583.1.69427 WP_003898583.1.69429 WP_003898583.1.6949 WP_003898583.1.6951 WP_003898583.1.69511 WP_003898583.1.69526 WP_003898583.1.69528 WP_003898583.1.69547 WP_003898583.1.69573 WP_003898583.1.69581 WP_003898583.1.6960 WP_003898583.1.69617 WP_003898583.1.69634 WP_003898583.1.69647 WP_003898583.1.69659 WP_003898583.1.69673 WP_003898583.1.69682 WP_003898583.1.69684 WP_003898583.1.69686 WP_003898583.1.69707 WP_003898583.1.69709 WP_003898583.1.69723 WP_003898583.1.69736 WP_003898583.1.69778 WP_003898583.1.69800 WP_003898583.1.69802 WP_003898583.1.69845 WP_003898583.1.69870 WP_003898583.1.69873 WP_003898583.1.69898 WP_003898583.1.69913 WP_003898583.1.69931 WP_003898583.1.69938 WP_003898583.1.69955 WP_003898583.1.69957 WP_003898583.1.69981 WP_003898583.1.69990 WP_003898583.1.70 WP_003898583.1.70000 WP_003898583.1.70017 WP_003898583.1.70032 WP_003898583.1.70055 WP_003898583.1.70062 WP_003898583.1.70072 WP_003898583.1.70131 WP_003898583.1.70132 WP_003898583.1.7022 WP_003898583.1.70227 WP_003898583.1.70255 WP_003898583.1.70271 WP_003898583.1.70274 WP_003898583.1.7029 WP_003898583.1.70325 WP_003898583.1.70328 WP_003898583.1.70356 WP_003898583.1.70364 WP_003898583.1.70368 WP_003898583.1.70369 WP_003898583.1.70418 WP_003898583.1.70422 WP_003898583.1.70435 WP_003898583.1.70444 WP_003898583.1.70463 WP_003898583.1.70471 WP_003898583.1.70480 WP_003898583.1.70494 WP_003898583.1.70498 WP_003898583.1.70525 WP_003898583.1.70573 WP_003898583.1.70577 WP_003898583.1.70610 WP_003898583.1.70615 WP_003898583.1.70618 WP_003898583.1.70622 WP_003898583.1.70626 WP_003898583.1.70668 WP_003898583.1.70699 WP_003898583.1.70704 WP_003898583.1.70729 WP_003898583.1.70757 WP_003898583.1.70782 WP_003898583.1.70796 WP_003898583.1.70834 WP_003898583.1.7084 WP_003898583.1.70840 WP_003898583.1.70864 WP_003898583.1.70871 WP_003898583.1.70915 WP_003898583.1.70958 WP_003898583.1.70964 WP_003898583.1.70976 WP_003898583.1.71015 WP_003898583.1.71063 WP_003898583.1.71076 WP_003898583.1.71083 WP_003898583.1.7111 WP_003898583.1.71118 WP_003898583.1.7113 WP_003898583.1.71187 WP_003898583.1.71191 WP_003898583.1.71255 WP_003898583.1.71258 WP_003898583.1.71259 WP_003898583.1.71289 WP_003898583.1.71326 WP_003898583.1.71329 WP_003898583.1.71331 WP_003898583.1.71344 WP_003898583.1.71390 WP_003898583.1.71414 WP_003898583.1.71440 WP_003898583.1.71457 WP_003898583.1.71464 WP_003898583.1.71490 WP_003898583.1.71492 WP_003898583.1.71509 WP_003898583.1.71516 WP_003898583.1.71517 WP_003898583.1.71527 WP_003898583.1.71532 WP_003898583.1.71545 WP_003898583.1.71546 WP_003898583.1.71569 WP_003898583.1.71604 WP_003898583.1.71630 WP_003898583.1.71638 WP_003898583.1.71654 WP_003898583.1.71664 WP_003898583.1.71665 WP_003898583.1.71683 WP_003898583.1.71701 WP_003898583.1.71718 WP_003898583.1.71731 WP_003898583.1.71781 WP_003898583.1.71803 WP_003898583.1.71847 WP_003898583.1.7185 WP_003898583.1.71851 WP_003898583.1.71871 WP_003898583.1.71909 WP_003898583.1.71957 WP_003898583.1.71970 WP_003898583.1.72047 WP_003898583.1.72061 WP_003898583.1.72062 WP_003898583.1.72072 WP_003898583.1.72111 WP_003898583.1.72122 WP_003898583.1.72143 WP_003898583.1.72168 WP_003898583.1.72179 WP_003898583.1.72209 WP_003898583.1.72227 WP_003898583.1.7224 WP_003898583.1.72268 WP_003898583.1.72332 WP_003898583.1.72380 WP_003898583.1.72401 WP_003898583.1.72405 WP_003898583.1.72420 WP_003898583.1.72441 WP_003898583.1.72451 WP_003898583.1.72452 WP_003898583.1.72457 WP_003898583.1.72459 WP_003898583.1.72460 WP_003898583.1.72466 WP_003898583.1.72487 WP_003898583.1.72488 WP_003898583.1.72492 WP_003898583.1.72506 WP_003898583.1.72543 WP_003898583.1.7256 WP_003898583.1.72576 WP_003898583.1.72578 WP_003898583.1.72585 WP_003898583.1.72591 WP_003898583.1.72592 WP_003898583.1.72640 WP_003898583.1.72661 WP_003898583.1.72739 WP_003898583.1.72744 WP_003898583.1.72755 WP_003898583.1.72759 WP_003898583.1.72784 WP_003898583.1.72792 WP_003898583.1.72826 WP_003898583.1.72831 WP_003898583.1.72852 WP_003898583.1.72853 WP_003898583.1.72879 WP_003898583.1.72880 WP_003898583.1.72938 WP_003898583.1.72954 WP_003898583.1.72957 WP_003898583.1.72959 WP_003898583.1.72982 WP_003898583.1.72988 WP_003898583.1.72993 WP_003898583.1.73006 WP_003898583.1.73013 WP_003898583.1.73025 WP_003898583.1.73028 WP_003898583.1.73042 WP_003898583.1.73045 WP_003898583.1.73092 WP_003898583.1.73118 WP_003898583.1.7312 WP_003898583.1.73127 WP_003898583.1.73134 WP_003898583.1.73154 WP_003898583.1.73163 WP_003898583.1.73182 WP_003898583.1.73205 WP_003898583.1.7321 WP_003898583.1.73310 WP_003898583.1.73365 WP_003898583.1.73391 WP_003898583.1.73404 WP_003898583.1.73424 WP_003898583.1.73436 WP_003898583.1.73445 WP_003898583.1.73453 WP_003898583.1.73465 WP_003898583.1.73466 WP_003898583.1.73470 WP_003898583.1.73471 WP_003898583.1.73478 WP_003898583.1.73482 WP_003898583.1.73507 WP_003898583.1.73532 WP_003898583.1.73550 WP_003898583.1.73564 WP_003898583.1.73623 WP_003898583.1.73629 WP_003898583.1.73644 WP_003898583.1.7366 WP_003898583.1.73661 WP_003898583.1.7368 WP_003898583.1.73688 WP_003898583.1.73723 WP_003898583.1.73744 WP_003898583.1.73750 WP_003898583.1.73760 WP_003898583.1.73774 WP_003898583.1.7379 WP_003898583.1.73813 WP_003898583.1.73840 WP_003898583.1.73876 WP_003898583.1.7389 WP_003898583.1.74016 WP_003898583.1.74039 WP_003898583.1.74083 WP_003898583.1.74101 WP_003898583.1.74107 WP_003898583.1.74129 WP_003898583.1.74144 WP_003898583.1.7417 WP_003898583.1.74190 WP_003898583.1.74210 WP_003898583.1.7423 WP_003898583.1.74259 WP_003898583.1.74262 WP_003898583.1.74269 WP_003898583.1.74282 WP_003898583.1.74291 WP_003898583.1.74296 WP_003898583.1.74304 WP_003898583.1.7432 WP_003898583.1.74347 WP_003898583.1.7436 WP_003898583.1.74378 WP_003898583.1.74382 WP_003898583.1.74395 WP_003898583.1.74400 WP_003898583.1.74432 WP_003898583.1.74442 WP_003898583.1.74487 WP_003898583.1.74499 WP_003898583.1.74504 WP_003898583.1.74511 WP_003898583.1.74523 WP_003898583.1.74525 WP_003898583.1.74551 WP_003898583.1.74555 WP_003898583.1.74628 WP_003898583.1.74641 WP_003898583.1.74653 WP_003898583.1.74660 WP_003898583.1.74683 WP_003898583.1.7469 WP_003898583.1.74725 WP_003898583.1.74760 WP_003898583.1.74809 WP_003898583.1.74820 WP_003898583.1.74870 WP_003898583.1.74881 WP_003898583.1.74888 WP_003898583.1.74952 WP_003898583.1.7496 WP_003898583.1.74988 WP_003898583.1.75043 WP_003898583.1.75055 WP_003898583.1.75078 WP_003898583.1.75081 WP_003898583.1.75120 WP_003898583.1.75163 WP_003898583.1.75188 WP_003898583.1.75200 WP_003898583.1.75202 WP_003898583.1.75234 WP_003898583.1.75239 WP_003898583.1.75263 WP_003898583.1.75342 WP_003898583.1.7535 WP_003898583.1.75376 WP_003898583.1.75391 WP_003898583.1.75395 WP_003898583.1.75441 WP_003898583.1.75510 WP_003898583.1.75581 WP_003898583.1.75598 WP_003898583.1.75635 WP_003898583.1.75665 WP_003898583.1.75671 WP_003898583.1.75741 WP_003898583.1.75749 WP_003898583.1.75772 WP_003898583.1.75774 WP_003898583.1.75833 WP_003898583.1.7585 WP_003898583.1.75868 WP_003898583.1.75878 WP_003898583.1.75927 WP_003898583.1.75946 WP_003898583.1.75968 WP_003898583.1.75974 WP_003898583.1.76016 WP_003898583.1.76032 WP_003898583.1.76037 WP_003898583.1.7604 WP_003898583.1.76045 WP_003898583.1.76052 WP_003898583.1.76058 WP_003898583.1.76064 WP_003898583.1.76110 WP_003898583.1.76126 WP_003898583.1.76133 WP_003898583.1.76138 WP_003898583.1.76157 WP_003898583.1.76172 WP_003898583.1.76177 WP_003898583.1.76183 WP_003898583.1.76209 WP_003898583.1.76272 WP_003898583.1.76277 WP_003898583.1.76281 WP_003898583.1.76291 WP_003898583.1.76297 WP_003898583.1.76360 WP_003898583.1.76379 WP_003898583.1.76403 WP_003898583.1.76413 WP_003898583.1.76414 WP_003898583.1.76427 WP_003898583.1.76436 WP_003898583.1.76442 WP_003898583.1.76443 WP_003898583.1.76456 WP_003898583.1.76533 WP_003898583.1.76616 WP_003898583.1.76625 WP_003898583.1.76629 WP_003898583.1.76635 WP_003898583.1.76638 WP_003898583.1.76640 WP_003898583.1.76644 WP_003898583.1.76677 WP_003898583.1.76678 WP_003898583.1.76679 WP_003898583.1.76734 WP_003898583.1.76744 WP_003898583.1.76750 WP_003898583.1.76754 WP_003898583.1.76757 WP_003898583.1.76781 WP_003898583.1.76818 WP_003898583.1.76824 WP_003898583.1.76835 WP_003898583.1.76873 WP_003898583.1.76888 WP_003898583.1.76900 WP_003898583.1.7691 WP_003898583.1.76947 WP_003898583.1.76954 WP_003898583.1.76955 WP_003898583.1.76963 WP_003898583.1.770 WP_003898583.1.77000 WP_003898583.1.77008 WP_003898583.1.77021 WP_003898583.1.77056 WP_003898583.1.77065 WP_003898583.1.77075 WP_003898583.1.77115 WP_003898583.1.77118 WP_003898583.1.77125 WP_003898583.1.77141 WP_003898583.1.77142 WP_003898583.1.77250 WP_003898583.1.77260 WP_003898583.1.77266 WP_003898583.1.77285 WP_003898583.1.77312 WP_003898583.1.77348 WP_003898583.1.77351 WP_003898583.1.77352 WP_003898583.1.77361 WP_003898583.1.774 WP_003898583.1.77404 WP_003898583.1.77425 WP_003898583.1.77463 WP_003898583.1.77474 WP_003898583.1.7748 WP_003898583.1.77484 WP_003898583.1.77491 WP_003898583.1.77499 WP_003898583.1.77510 WP_003898583.1.77530 WP_003898583.1.77554 WP_003898583.1.77559 WP_003898583.1.77599 WP_003898583.1.7762 WP_003898583.1.77627 WP_003898583.1.77649 WP_003898583.1.77654 WP_003898583.1.7766 WP_003898583.1.77667 WP_003898583.1.77704 WP_003898583.1.77706 WP_003898583.1.77774 WP_003898583.1.7778 WP_003898583.1.77790 WP_003898583.1.77809 WP_003898583.1.77820 WP_003898583.1.77843 WP_003898583.1.77855 WP_003898583.1.77865 WP_003898583.1.77868 WP_003898583.1.77890 WP_003898583.1.77909 WP_003898583.1.77911 WP_003898583.1.77931 WP_003898583.1.77984 WP_003898583.1.78020 WP_003898583.1.78024 WP_003898583.1.78075 WP_003898583.1.78086 WP_003898583.1.7809 WP_003898583.1.78098 WP_003898583.1.78105 WP_003898583.1.78113 WP_003898583.1.78136 WP_003898583.1.78162 WP_003898583.1.7817 WP_003898583.1.78200 WP_003898583.1.78216 WP_003898583.1.78236 WP_003898583.1.78238 WP_003898583.1.78322 WP_003898583.1.78338 WP_003898583.1.7836 WP_003898583.1.78360 WP_003898583.1.78386 WP_003898583.1.78435 WP_003898583.1.7844 WP_003898583.1.78459 WP_003898583.1.78488 WP_003898583.1.7849 WP_003898583.1.78499 WP_003898583.1.785 WP_003898583.1.78516 WP_003898583.1.78524 WP_003898583.1.78526 WP_003898583.1.78538 WP_003898583.1.78545 WP_003898583.1.78547 WP_003898583.1.78574 WP_003898583.1.78580 WP_003898583.1.78620 WP_003898583.1.78646 WP_003898583.1.78648 WP_003898583.1.78649 WP_003898583.1.78655 WP_003898583.1.78657 WP_003898583.1.78659 WP_003898583.1.7869 WP_003898583.1.78692 WP_003898583.1.78760 WP_003898583.1.78766 WP_003898583.1.78776 WP_003898583.1.78778 WP_003898583.1.78784 WP_003898583.1.78788 WP_003898583.1.78790 WP_003898583.1.78860 WP_003898583.1.7887 WP_003898583.1.78884 WP_003898583.1.78932 WP_003898583.1.78969 WP_003898583.1.78977 WP_003898583.1.78980 WP_003898583.1.79005 WP_003898583.1.79016 WP_003898583.1.79033 WP_003898583.1.79064 WP_003898583.1.79066 WP_003898583.1.79068 WP_003898583.1.79095 WP_003898583.1.79112 WP_003898583.1.79122 WP_003898583.1.79145 WP_003898583.1.79152 WP_003898583.1.79163 WP_003898583.1.79182 WP_003898583.1.79213 WP_003898583.1.79218 WP_003898583.1.79268 WP_003898583.1.79278 WP_003898583.1.79290 WP_003898583.1.79319 WP_003898583.1.79326 WP_003898583.1.7933 WP_003898583.1.79330 WP_003898583.1.79339 WP_003898583.1.79394 WP_003898583.1.79399 WP_003898583.1.79413 WP_003898583.1.79422 WP_003898583.1.79445 WP_003898583.1.79447 WP_003898583.1.79455 WP_003898583.1.79471 WP_003898583.1.79480 WP_003898583.1.79482 WP_003898583.1.79488 WP_003898583.1.79500 WP_003898583.1.79502 WP_003898583.1.79508 WP_003898583.1.79514 WP_003898583.1.79561 WP_003898583.1.79565 WP_003898583.1.79578 WP_003898583.1.79588 WP_003898583.1.79598 WP_003898583.1.79615 WP_003898583.1.79684 WP_003898583.1.79698 WP_003898583.1.797 WP_003898583.1.79744 WP_003898583.1.79784 WP_003898583.1.79806 WP_003898583.1.79819 WP_003898583.1.79826 WP_003898583.1.79828 WP_003898583.1.79851 WP_003898583.1.79853 WP_003898583.1.79863 WP_003898583.1.79881 WP_003898583.1.79885 WP_003898583.1.79898 WP_003898583.1.7990 WP_003898583.1.79900 WP_003898583.1.79913 WP_003898583.1.79918 WP_003898583.1.79947 WP_003898583.1.79948 WP_003898583.1.7995 WP_003898583.1.7997 WP_003898583.1.80004 WP_003898583.1.80022 WP_003898583.1.80030 WP_003898583.1.80054 WP_003898583.1.80084 WP_003898583.1.80099 WP_003898583.1.80129 WP_003898583.1.80177 WP_003898583.1.80234 WP_003898583.1.8026 WP_003898583.1.80275 WP_003898583.1.8029 WP_003898583.1.80299 WP_003898583.1.80304 WP_003898583.1.80326 WP_003898583.1.8037 WP_003898583.1.80370 WP_003898583.1.8044 WP_003898583.1.80451 WP_003898583.1.80458 WP_003898583.1.80461 WP_003898583.1.80490 WP_003898583.1.80503 WP_003898583.1.80507 WP_003898583.1.80552 WP_003898583.1.80576 WP_003898583.1.80588 WP_003898583.1.80599 WP_003898583.1.8060 WP_003898583.1.80624 WP_003898583.1.80636 WP_003898583.1.80673 WP_003898583.1.80711 WP_003898583.1.80714 WP_003898583.1.80743 WP_003898583.1.80784 WP_003898583.1.80815 WP_003898583.1.80853 WP_003898583.1.80918 WP_003898583.1.8093 WP_003898583.1.80967 WP_003898583.1.8097 WP_003898583.1.80988 WP_003898583.1.81007 WP_003898583.1.81013 WP_003898583.1.8105 WP_003898583.1.81059 WP_003898583.1.81063 WP_003898583.1.81066 WP_003898583.1.81075 WP_003898583.1.81091 WP_003898583.1.81119 WP_003898583.1.81125 WP_003898583.1.81136 WP_003898583.1.8114 WP_003898583.1.81189 WP_003898583.1.81192 WP_003898583.1.812 WP_003898583.1.81230 WP_003898583.1.81249 WP_003898583.1.81250 WP_003898583.1.81264 WP_003898583.1.8128 WP_003898583.1.81287 WP_003898583.1.81297 WP_003898583.1.8138 WP_003898583.1.81407 WP_003898583.1.8143 WP_003898583.1.81439 WP_003898583.1.81465 WP_003898583.1.81529 WP_003898583.1.81538 WP_003898583.1.81541 WP_003898583.1.81560 WP_003898583.1.81561 WP_003898583.1.81567 WP_003898583.1.81583 WP_003898583.1.81686 WP_003898583.1.81712 WP_003898583.1.81720 WP_003898583.1.81731 WP_003898583.1.81774 WP_003898583.1.81788 WP_003898583.1.81820 WP_003898583.1.81850 WP_003898583.1.81883 WP_003898583.1.81891 WP_003898583.1.81911 WP_003898583.1.81918 WP_003898583.1.82011 WP_003898583.1.82048 WP_003898583.1.82069 WP_003898583.1.82071 WP_003898583.1.82108 WP_003898583.1.82136 WP_003898583.1.82142 WP_003898583.1.8215 WP_003898583.1.82158 WP_003898583.1.82209 WP_003898583.1.82210 WP_003898583.1.82228 WP_003898583.1.82236 WP_003898583.1.82251 WP_003898583.1.82271 WP_003898583.1.82305 WP_003898583.1.82307 WP_003898583.1.82317 WP_003898583.1.8232 WP_003898583.1.82346 WP_003898583.1.82374 WP_003898583.1.82385 WP_003898583.1.82429 WP_003898583.1.82460 WP_003898583.1.82483 WP_003898583.1.82494 WP_003898583.1.82531 WP_003898583.1.82546 WP_003898583.1.82547 WP_003898583.1.82549 WP_003898583.1.82577 WP_003898583.1.82592 WP_003898583.1.82597 WP_003898583.1.82598 WP_003898583.1.82625 WP_003898583.1.82642 WP_003898583.1.82651 WP_003898583.1.82653 WP_003898583.1.82681 WP_003898583.1.82685 WP_003898583.1.8271 WP_003898583.1.82712 WP_003898583.1.8273 WP_003898583.1.82743 WP_003898583.1.82757 WP_003898583.1.82774 WP_003898583.1.82803 WP_003898583.1.82860 WP_003898583.1.82871 WP_003898583.1.82892 WP_003898583.1.82935 WP_003898583.1.82957 WP_003898583.1.82983 WP_003898583.1.83009 WP_003898583.1.83044 WP_003898583.1.83074 WP_003898583.1.83146 WP_003898583.1.83149 WP_003898583.1.83159 WP_003898583.1.8317 WP_003898583.1.83173 WP_003898583.1.83181 WP_003898583.1.83182 WP_003898583.1.83191 WP_003898583.1.83197 WP_003898583.1.83212 WP_003898583.1.8326 WP_003898583.1.83262 WP_003898583.1.83273 WP_003898583.1.83309 WP_003898583.1.83332 WP_003898583.1.83334 WP_003898583.1.83341 WP_003898583.1.83349 WP_003898583.1.8335 WP_003898583.1.83353 WP_003898583.1.83367 WP_003898583.1.83380 WP_003898583.1.83381 WP_003898583.1.83389 WP_003898583.1.83408 WP_003898583.1.83409 WP_003898583.1.83435 WP_003898583.1.83470 WP_003898583.1.83524 WP_003898583.1.83526 WP_003898583.1.8358 WP_003898583.1.83589 WP_003898583.1.83601 WP_003898583.1.83611 WP_003898583.1.83638 WP_003898583.1.83656 WP_003898583.1.83667 WP_003898583.1.83689 WP_003898583.1.83692 WP_003898583.1.83705 WP_003898583.1.83766 WP_003898583.1.83793 WP_003898583.1.83794 WP_003898583.1.83802 WP_003898583.1.83805 WP_003898583.1.83839 WP_003898583.1.83842 WP_003898583.1.83850 WP_003898583.1.83861 WP_003898583.1.83884 WP_003898583.1.83920 WP_003898583.1.83929 WP_003898583.1.83930 WP_003898583.1.83975 WP_003898583.1.83991 WP_003898583.1.8400 WP_003898583.1.84027 WP_003898583.1.8404 WP_003898583.1.84057 WP_003898583.1.84070 WP_003898583.1.8409 WP_003898583.1.84112 WP_003898583.1.84146 WP_003898583.1.8415 WP_003898583.1.84176 WP_003898583.1.84192 WP_003898583.1.84228 WP_003898583.1.8424 WP_003898583.1.84244 WP_003898583.1.84259 WP_003898583.1.8426 WP_003898583.1.84277 WP_003898583.1.84287 WP_003898583.1.8434 WP_003898583.1.84388 WP_003898583.1.84409 WP_003898583.1.84438 WP_003898583.1.84460 WP_003898583.1.84488 WP_003898583.1.84504 WP_003898583.1.84525 WP_003898583.1.84620 WP_003898583.1.84623 WP_003898583.1.84641 WP_003898583.1.84655 WP_003898583.1.84666 WP_003898583.1.84670 WP_003898583.1.84739 WP_003898583.1.84748 WP_003898583.1.84766 WP_003898583.1.84772 WP_003898583.1.84774 WP_003898583.1.848 WP_003898583.1.84812 WP_003898583.1.84836 WP_003898583.1.84839 WP_003898583.1.84846 WP_003898583.1.84873 WP_003898583.1.84938 WP_003898583.1.84968 WP_003898583.1.84973 WP_003898583.1.84981 WP_003898583.1.84985 WP_003898583.1.8503 WP_003898583.1.85038 WP_003898583.1.85043 WP_003898583.1.8505 WP_003898583.1.85074 WP_003898583.1.8509 WP_003898583.1.8512 WP_003898583.1.85148 WP_003898583.1.8518 WP_003898583.1.8522 WP_003898583.1.85242 WP_003898583.1.85276 WP_003898583.1.85281 WP_003898583.1.85284 WP_003898583.1.85314 WP_003898583.1.85319 WP_003898583.1.85330 WP_003898583.1.85341 WP_003898583.1.8535 WP_003898583.1.85363 WP_003898583.1.85371 WP_003898583.1.85377 WP_003898583.1.85387 WP_003898583.1.85399 WP_003898583.1.85458 WP_003898583.1.8546 WP_003898583.1.85478 WP_003898583.1.85480 WP_003898583.1.85488 WP_003898583.1.85495 WP_003898583.1.85551 WP_003898583.1.85557 WP_003898583.1.85577 WP_003898583.1.85599 WP_003898583.1.85610 WP_003898583.1.8563 WP_003898583.1.85648 WP_003898583.1.85679 WP_003898583.1.85704 WP_003898583.1.85727 WP_003898583.1.85737 WP_003898583.1.85763 WP_003898583.1.85808 WP_003898583.1.85819 WP_003898583.1.85820 WP_003898583.1.85823 WP_003898583.1.85832 WP_003898583.1.8586 WP_003898583.1.85872 WP_003898583.1.85894 WP_003898583.1.85909 WP_003898583.1.85913 WP_003898583.1.85953 WP_003898583.1.85986 WP_003898583.1.86000 WP_003898583.1.86025 WP_003898583.1.86032 WP_003898583.1.86048 WP_003898583.1.86052 WP_003898583.1.86067 WP_003898583.1.86103 WP_003898583.1.86122 WP_003898583.1.86124 WP_003898583.1.86160 WP_003898583.1.86164 WP_003898583.1.86168 WP_003898583.1.86190 WP_003898583.1.86204 WP_003898583.1.86208 WP_003898583.1.86235 WP_003898583.1.86249 WP_003898583.1.86260 WP_003898583.1.86290 WP_003898583.1.863 WP_003898583.1.86327 WP_003898583.1.86334 WP_003898583.1.86337 WP_003898583.1.86368 WP_003898583.1.86377 WP_003898583.1.86425 WP_003898583.1.86459 WP_003898583.1.8649 WP_003898583.1.86499 WP_003898583.1.86520 WP_003898583.1.86561 WP_003898583.1.86568 WP_003898583.1.86575 WP_003898583.1.86584 WP_003898583.1.86605 WP_003898583.1.86626 WP_003898583.1.86648 WP_003898583.1.86684 WP_003898583.1.86705 WP_003898583.1.86718 WP_003898583.1.86725 WP_003898583.1.86757 WP_003898583.1.86766 WP_003898583.1.86801 WP_003898583.1.86814 WP_003898583.1.86820 WP_003898583.1.86825 WP_003898583.1.86834 WP_003898583.1.8685 WP_003898583.1.86851 WP_003898583.1.86855 WP_003898583.1.86867 WP_003898583.1.86877 WP_003898583.1.86883 WP_003898583.1.8689 WP_003898583.1.86892 WP_003898583.1.86933 WP_003898583.1.86941 WP_003898583.1.86950 WP_003898583.1.86962 WP_003898583.1.86963 WP_003898583.1.86979 WP_003898583.1.8700 WP_003898583.1.87002 WP_003898583.1.87031 WP_003898583.1.87116 WP_003898583.1.87117 WP_003898583.1.8714 WP_003898583.1.87178 WP_003898583.1.87191 WP_003898583.1.87201 WP_003898583.1.87209 WP_003898583.1.87240 WP_003898583.1.87266 WP_003898583.1.87273 WP_003898583.1.87275 WP_003898583.1.8733 WP_003898583.1.87345 WP_003898583.1.8737 WP_003898583.1.87401 WP_003898583.1.87409 WP_003898583.1.87444 WP_003898583.1.87446 WP_003898583.1.87459 WP_003898583.1.87472 WP_003898583.1.87489 WP_003898583.1.87494 WP_003898583.1.87496 WP_003898583.1.87582 WP_003898583.1.87588 WP_003898583.1.87617 WP_003898583.1.87619 WP_003898583.1.87620 WP_003898583.1.87634 WP_003898583.1.87643 WP_003898583.1.8765 WP_003898583.1.87650 WP_003898583.1.87654 WP_003898583.1.87658 WP_003898583.1.87665 WP_003898583.1.87676 WP_003898583.1.87677 WP_003898583.1.87684 WP_003898583.1.87692 WP_003898583.1.87707 WP_003898583.1.87732 WP_003898583.1.87784 WP_003898583.1.87796 WP_003898583.1.87809 WP_003898583.1.87817 WP_003898583.1.87827 WP_003898583.1.87831 WP_003898583.1.87835 WP_003898583.1.87837 WP_003898583.1.87866 WP_003898583.1.8789 WP_003898583.1.87911 WP_003898583.1.87924 WP_003898583.1.87951 WP_003898583.1.87956 WP_003898583.1.87991 WP_003898583.1.88 WP_003898583.1.88002 WP_003898583.1.88037 WP_003898583.1.88039 WP_003898583.1.88072 WP_003898583.1.88077 WP_003898583.1.88121 WP_003898583.1.88191 WP_003898583.1.88205 WP_003898583.1.88217 WP_003898583.1.88219 WP_003898583.1.88245 WP_003898583.1.88253 WP_003898583.1.88294 WP_003898583.1.88315 WP_003898583.1.88316 WP_003898583.1.88320 WP_003898583.1.88338 WP_003898583.1.8840 WP_003898583.1.88437 WP_003898583.1.88453 WP_003898583.1.88469 WP_003898583.1.88489 WP_003898583.1.88507 WP_003898583.1.88530 WP_003898583.1.88537 WP_003898583.1.88541 WP_003898583.1.88592 WP_003898583.1.88616 WP_003898583.1.88618 WP_003898583.1.8862 WP_003898583.1.88625 WP_003898583.1.88632 WP_003898583.1.88634 WP_003898583.1.88649 WP_003898583.1.8870 WP_003898583.1.88737 WP_003898583.1.88756 WP_003898583.1.888 WP_003898583.1.88824 WP_003898583.1.88886 WP_003898583.1.88965 WP_003898583.1.88985 WP_003898583.1.8902 WP_003898583.1.89025 WP_003898583.1.89041 WP_003898583.1.89046 WP_003898583.1.89082 WP_003898583.1.89162 WP_003898583.1.89168 WP_003898583.1.8917 WP_003898583.1.89205 WP_003898583.1.89207 WP_003898583.1.89225 WP_003898583.1.8925 WP_003898583.1.89277 WP_003898583.1.89286 WP_003898583.1.89293 WP_003898583.1.89320 WP_003898583.1.8935 WP_003898583.1.89371 WP_003898583.1.89378 WP_003898583.1.89392 WP_003898583.1.89406 WP_003898583.1.89451 WP_003898583.1.89453 WP_003898583.1.89473 WP_003898583.1.89475 WP_003898583.1.89483 WP_003898583.1.895 WP_003898583.1.89513 WP_003898583.1.89517 WP_003898583.1.89522 WP_003898583.1.8954 WP_003898583.1.89543 WP_003898583.1.8957 WP_003898583.1.89572 WP_003898583.1.89589 WP_003898583.1.89607 WP_003898583.1.89613 WP_003898583.1.89625 WP_003898583.1.89648 WP_003898583.1.8967 WP_003898583.1.89670 WP_003898583.1.89676 WP_003898583.1.89729 WP_003898583.1.89739 WP_003898583.1.89762 WP_003898583.1.8977 WP_003898583.1.89808 WP_003898583.1.8982 WP_003898583.1.89829 WP_003898583.1.89831 WP_003898583.1.89844 WP_003898583.1.89849 WP_003898583.1.8989 WP_003898583.1.89901 WP_003898583.1.89903 WP_003898583.1.89909 WP_003898583.1.89922 WP_003898583.1.89926 WP_003898583.1.89963 WP_003898583.1.89971 WP_003898583.1.8998 WP_003898583.1.89987 WP_003898583.1.900 WP_003898583.1.90048 WP_003898583.1.9007 WP_003898583.1.90080 WP_003898583.1.90130 WP_003898583.1.90134 WP_003898583.1.90137 WP_003898583.1.90157 WP_003898583.1.90184 WP_003898583.1.90199 WP_003898583.1.90231 WP_003898583.1.90245 WP_003898583.1.90308 WP_003898583.1.90322 WP_003898583.1.90328 WP_003898583.1.90372 WP_003898583.1.90481 WP_003898583.1.90499 WP_003898583.1.9050 WP_003898583.1.90527 WP_003898583.1.90550 WP_003898583.1.90560 WP_003898583.1.90612 WP_003898583.1.90640 WP_003898583.1.90672 WP_003898583.1.90687 WP_003898583.1.90691 WP_003898583.1.90711 WP_003898583.1.90722 WP_003898583.1.90744 WP_003898583.1.9075 WP_003898583.1.90756 WP_003898583.1.90767 WP_003898583.1.90771 WP_003898583.1.90785 WP_003898583.1.90788 WP_003898583.1.90800 WP_003898583.1.90810 WP_003898583.1.90816 WP_003898583.1.90819 WP_003898583.1.9082 WP_003898583.1.90884 WP_003898583.1.90899 WP_003898583.1.90906 WP_003898583.1.90958 WP_003898583.1.90976 WP_003898583.1.90977 WP_003898583.1.90987 WP_003898583.1.9102 WP_003898583.1.91026 WP_003898583.1.91032 WP_003898583.1.91053 WP_003898583.1.91082 WP_003898583.1.91106 WP_003898583.1.91112 WP_003898583.1.91144 WP_003898583.1.91151 WP_003898583.1.91157 WP_003898583.1.91167 WP_003898583.1.91169 WP_003898583.1.91192 WP_003898583.1.91201 WP_003898583.1.91207 WP_003898583.1.91208 WP_003898583.1.91211 WP_003898583.1.91214 WP_003898583.1.91230 WP_003898583.1.91244 WP_003898583.1.91251 WP_003898583.1.91260 WP_003898583.1.91284 WP_003898583.1.91294 WP_003898583.1.91303 WP_003898583.1.91322 WP_003898583.1.91386 WP_003898583.1.9139 WP_003898583.1.91398 WP_003898583.1.91430 WP_003898583.1.91436 WP_003898583.1.91483 WP_003898583.1.91496 WP_003898583.1.91507 WP_003898583.1.91576 WP_003898583.1.91589 WP_003898583.1.91694 WP_003898583.1.91695 WP_003898583.1.91716 WP_003898583.1.91717 WP_003898583.1.91728 WP_003898583.1.91743 WP_003898583.1.91759 WP_003898583.1.91784 WP_003898583.1.91785 WP_003898583.1.91786 WP_003898583.1.91802 WP_003898583.1.91822 WP_003898583.1.91828 WP_003898583.1.9189 WP_003898583.1.91896 WP_003898583.1.9190 WP_003898583.1.91915 WP_003898583.1.91931 WP_003898583.1.91937 WP_003898583.1.91944 WP_003898583.1.91953 WP_003898583.1.91957 WP_003898583.1.91976 WP_003898583.1.92083 WP_003898583.1.92127 WP_003898583.1.92144 WP_003898583.1.92150 WP_003898583.1.92153 WP_003898583.1.92190 WP_003898583.1.92192 WP_003898583.1.92200 WP_003898583.1.92220 WP_003898583.1.92221 WP_003898583.1.92222 WP_003898583.1.92273 WP_003898583.1.92289 WP_003898583.1.9229 WP_003898583.1.92294 WP_003898583.1.92300 WP_003898583.1.92317 WP_003898583.1.92334 WP_003898583.1.92338 WP_003898583.1.92345 WP_003898583.1.92356 WP_003898583.1.92364 WP_003898583.1.92380 WP_003898583.1.92428 WP_003898583.1.92447 WP_003898583.1.92456 WP_003898583.1.92467 WP_003898583.1.92471 WP_003898583.1.92490 WP_003898583.1.92508 WP_003898583.1.9251 WP_003898583.1.92511 WP_003898583.1.92523 WP_003898583.1.92527 WP_003898583.1.92536 WP_003898583.1.92592 WP_003898583.1.92603 WP_003898583.1.92606 WP_003898583.1.92610 WP_003898583.1.92613 WP_003898583.1.9263 WP_003898583.1.9265 WP_003898583.1.92650 WP_003898583.1.92660 WP_003898583.1.92677 WP_003898583.1.92685 WP_003898583.1.92689 WP_003898583.1.92690 WP_003898583.1.92714 WP_003898583.1.92736 WP_003898583.1.9274 WP_003898583.1.92752 WP_003898583.1.92760 WP_003898583.1.92777 WP_003898583.1.92803 WP_003898583.1.92833 WP_003898583.1.92856 WP_003898583.1.92881 WP_003898583.1.92892 WP_003898583.1.92907 WP_003898583.1.92908 WP_003898583.1.9291 WP_003898583.1.92917 WP_003898583.1.92996 WP_003898583.1.93006 WP_003898583.1.93009 WP_003898583.1.93015 WP_003898583.1.93043 WP_003898583.1.9307 WP_003898583.1.93083 WP_003898583.1.93097 WP_003898583.1.93137 WP_003898583.1.93192 WP_003898583.1.93199 WP_003898583.1.93203 WP_003898583.1.93212 WP_003898583.1.93234 WP_003898583.1.93245 WP_003898583.1.93257 WP_003898583.1.93265 WP_003898583.1.93297 WP_003898583.1.93320 WP_003898583.1.93328 WP_003898583.1.93337 WP_003898583.1.93343 WP_003898583.1.93349 WP_003898583.1.93363 WP_003898583.1.93377 WP_003898583.1.9338 WP_003898583.1.93407 WP_003898583.1.93417 WP_003898583.1.93419 WP_003898583.1.93426 WP_003898583.1.9344 WP_003898583.1.93443 WP_003898583.1.93447 WP_003898583.1.93470 WP_003898583.1.93483 WP_003898583.1.93487 WP_003898583.1.93495 WP_003898583.1.93499 WP_003898583.1.93516 WP_003898583.1.93536 WP_003898583.1.93544 WP_003898583.1.93555 WP_003898583.1.93560 WP_003898583.1.93564 WP_003898583.1.9357 WP_003898583.1.93573 WP_003898583.1.93576 WP_003898583.1.93588 WP_003898583.1.9363 WP_003898583.1.93645 WP_003898583.1.93649 WP_003898583.1.93659 WP_003898583.1.93677 WP_003898583.1.9368 WP_003898583.1.93689 WP_003898583.1.93693 WP_003898583.1.93698 WP_003898583.1.93706 WP_003898583.1.9371 WP_003898583.1.93792 WP_003898583.1.93823 WP_003898583.1.93871 WP_003898583.1.9388 WP_003898583.1.93894 WP_003898583.1.93903 WP_003898583.1.93907 WP_003898583.1.93913 WP_003898583.1.93946 WP_003898583.1.93950 WP_003898583.1.93953 WP_003898583.1.93954 WP_003898583.1.93988 WP_003898583.1.9407 WP_003898583.1.94143 WP_003898583.1.94154 WP_003898583.1.94204 WP_003898583.1.94205 WP_003898583.1.94226 WP_003898583.1.94231 WP_003898583.1.94256 WP_003898583.1.94261 WP_003898583.1.94281 WP_003898583.1.94292 WP_003898583.1.94297 WP_003898583.1.9431 WP_003898583.1.94326 WP_003898583.1.94339 WP_003898583.1.94392 WP_003898583.1.94416 WP_003898583.1.94421 WP_003898583.1.94456 WP_003898583.1.94480 WP_003898583.1.94495 WP_003898583.1.94511 WP_003898583.1.94512 WP_003898583.1.94528 WP_003898583.1.94564 WP_003898583.1.946 WP_003898583.1.94623 WP_003898583.1.94629 WP_003898583.1.9465 WP_003898583.1.94673 WP_003898583.1.94714 WP_003898583.1.94730 WP_003898583.1.94736 WP_003898583.1.94776 WP_003898583.1.9478 WP_003898583.1.94834 WP_003898583.1.94852 WP_003898583.1.94872 WP_003898583.1.9488 WP_003898583.1.94902 WP_003898583.1.94916 WP_003898583.1.94979 WP_003898583.1.94994 WP_003898583.1.94996 WP_003898583.1.94998 WP_003898583.1.95007 WP_003898583.1.95010 WP_003898583.1.95015 WP_003898583.1.95034 WP_003898583.1.95068 WP_003898583.1.95081 WP_003898583.1.95082 WP_003898583.1.9509 WP_003898583.1.95096 WP_003898583.1.95112 WP_003898583.1.95138 WP_003898583.1.9514 WP_003898583.1.95179 WP_003898583.1.95188 WP_003898583.1.95190 WP_003898583.1.95234 WP_003898583.1.95241 WP_003898583.1.95245 WP_003898583.1.95257 WP_003898583.1.95279 WP_003898583.1.9531 WP_003898583.1.95335 WP_003898583.1.95344 WP_003898583.1.9535 WP_003898583.1.95370 WP_003898583.1.95392 WP_003898583.1.95416 WP_003898583.1.95417 WP_003898583.1.95454 WP_003898583.1.95455 WP_003898583.1.95491 WP_003898583.1.95497 WP_003898583.1.95508 WP_003898583.1.95509 WP_003898583.1.95529 WP_003898583.1.95556 WP_003898583.1.95557 WP_003898583.1.95565 WP_003898583.1.95578 WP_003898583.1.95580 WP_003898583.1.95585 WP_003898583.1.95643 WP_003898583.1.95679 WP_003898583.1.95685 WP_003898583.1.957 WP_003898583.1.95724 WP_003898583.1.95727 WP_003898583.1.95730 WP_003898583.1.95735 WP_003898583.1.95758 WP_003898583.1.95772 WP_003898583.1.95797 WP_003898583.1.95839 WP_003898583.1.9585 WP_003898583.1.9590 WP_003898583.1.95902 WP_003898583.1.95924 WP_003898583.1.95926 WP_003898583.1.95953 WP_003898583.1.95958 WP_003898583.1.95964 WP_003898583.1.95973 WP_003898583.1.96006 WP_003898583.1.9602 WP_003898583.1.96036 WP_003898583.1.96062 WP_003898583.1.96065 WP_003898583.1.96098 WP_003898583.1.96146 WP_003898583.1.96171 WP_003898583.1.96182 WP_003898583.1.96230 WP_003898583.1.96242 WP_003898583.1.96245 WP_003898583.1.96254 WP_003898583.1.96259 WP_003898583.1.96286 WP_003898583.1.96313 WP_003898583.1.96318 WP_003898583.1.96345 WP_003898583.1.96360 WP_003898583.1.96373 WP_003898583.1.96456 WP_003898583.1.96486 WP_003898583.1.96569 WP_003898583.1.96573 WP_003898583.1.96576 WP_003898583.1.96611 WP_003898583.1.96621 WP_003898583.1.9667 WP_003898583.1.96681 WP_003898583.1.96726 WP_003898583.1.96733 WP_003898583.1.96742 WP_003898583.1.96754 WP_003898583.1.9678 WP_003898583.1.9685 WP_003898583.1.97008 WP_003898583.1.97009 WP_003898583.1.97056 WP_003898583.1.97084 WP_003898583.1.97087 WP_003898583.1.97094 WP_003898583.1.97096 WP_003898583.1.97099 WP_003898583.1.97108 WP_003898583.1.97113 WP_003898583.1.97122 WP_003898583.1.97129 WP_003898583.1.97136 WP_003898583.1.9716 WP_003898583.1.97176 WP_003898583.1.97222 WP_003898583.1.97237 WP_003898583.1.97242 WP_003898583.1.97270 WP_003898583.1.97283 WP_003898583.1.97296 WP_003898583.1.97321 WP_003898583.1.97325 WP_003898583.1.97366 WP_003898583.1.97376 WP_003898583.1.97380 WP_003898583.1.97462 WP_003898583.1.97517 WP_003898583.1.97519 WP_003898583.1.97535 WP_003898583.1.97540 WP_003898583.1.97545 WP_003898583.1.97546 WP_003898583.1.97550 WP_003898583.1.97577 WP_003898583.1.97584 WP_003898583.1.9759 WP_003898583.1.97591 WP_003898583.1.97609 WP_003898583.1.97618 WP_003898583.1.9763 WP_003898583.1.97669 WP_003898583.1.97673 WP_003898583.1.97700 WP_003898583.1.97701 WP_003898583.1.9773 WP_003898583.1.97730 WP_003898583.1.97740 WP_003898583.1.97751 WP_003898583.1.97754 WP_003898583.1.97797 WP_003898583.1.9782 WP_003898583.1.9784 WP_003898583.1.97888 WP_003898583.1.9795 WP_003898583.1.97951 WP_003898583.1.97958 WP_003898583.1.97966 WP_003898583.1.97977 WP_003898583.1.97979 WP_003898583.1.97995 WP_003898583.1.98018 WP_003898583.1.98034 WP_003898583.1.98052 WP_003898583.1.98071 WP_003898583.1.98072 WP_003898583.1.98113 WP_003898583.1.98114 WP_003898583.1.98128 WP_003898583.1.98188 WP_003898583.1.98189 WP_003898583.1.98213 WP_003898583.1.98225 WP_003898583.1.98291 WP_003898583.1.98335 WP_003898583.1.98350 WP_003898583.1.98395 WP_003898583.1.98412 WP_003898583.1.98441 WP_003898583.1.98443 WP_003898583.1.98462 WP_003898583.1.9848 WP_003898583.1.98482 WP_003898583.1.98486 WP_003898583.1.98488 WP_003898583.1.98503 WP_003898583.1.98516 WP_003898583.1.98536 WP_003898583.1.98541 WP_003898583.1.98566 WP_003898583.1.98576 WP_003898583.1.98590 WP_003898583.1.98594 WP_003898583.1.98599 WP_003898583.1.98629 WP_003898583.1.98645 WP_003898583.1.98646 WP_003898583.1.98649 WP_003898583.1.98656 WP_003898583.1.9867 WP_003898583.1.98674 WP_003898583.1.98697 WP_003898583.1.98701 WP_003898583.1.98739 WP_003898583.1.98749 WP_003898583.1.98765 WP_003898583.1.98770 WP_003898583.1.98777 WP_003898583.1.98778 WP_003898583.1.98802 WP_003898583.1.98838 WP_003898583.1.98906 WP_003898583.1.98935 WP_003898583.1.98948 WP_003898583.1.98953 WP_003898583.1.98984 WP_003898583.1.99000 WP_003898583.1.99023 WP_003898583.1.99030 WP_003898583.1.99055 WP_003898583.1.99062 WP_003898583.1.99086 WP_003898583.1.99115 WP_003898583.1.99161 WP_003898583.1.99176 WP_003898583.1.99211 WP_003898583.1.99216 WP_003898583.1.99222 WP_003898583.1.99251 WP_003898583.1.99294 WP_003898583.1.99312 WP_003898583.1.99315 WP_003898583.1.99316 WP_003898583.1.99322 WP_003898583.1.99328 WP_003898583.1.99365 WP_003898583.1.99368 WP_003898583.1.99396 WP_003898583.1.99402 WP_003898583.1.99419 WP_003898583.1.99438 WP_003898583.1.99460 WP_003898583.1.99468 WP_003898583.1.99473 WP_003898583.1.99513 WP_003898583.1.99529 WP_003898583.1.99548 WP_003898583.1.99572 WP_003898583.1.99575 WP_003898583.1.99578 WP_003898583.1.99605 WP_003898583.1.99609 WP_003898583.1.99617 WP_003898583.1.99635 WP_003898583.1.99650 WP_003898583.1.99672 WP_003898583.1.99701 WP_003898583.1.99711 WP_003898583.1.99716 WP_003898583.1.99740 WP_003898583.1.99745 WP_003898583.1.99749 WP_003898583.1.9976 WP_003898583.1.99798 WP_003898583.1.99817 WP_003898583.1.99847 WP_003898583.1.99852 WP_003898583.1.99886 WP_003898583.1.99897 WP_003898583.1.99899 WP_003898583.1.99915 WP_003898583.1.99991 gi|385990245|ref|YP_005908543.1| gi|148821983|ref|YP_001286737.1| gi|15607917|ref|NP_215291.1| gi|392431205|ref|YP_006472249.1| gi|253797723|ref|YP_003030724.1| gi|506925202|ref|YP_008005652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]