SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15608473|ref|NP_215849.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15608473|ref|NP_215849.1|
Domain Number 1 Region: 1-339
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.92e-80
Family DmpA-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15608473|ref|NP_215849.1|
Sequence length 344
Comment Probable hydrolase [Mycobacterium tuberculosis H37Rv]
Sequence
MNSITDVGGIRVGHYQRLDPDASLGAGWACGVTVVLPPPGTVGAVDCRGGAPGTRETDLL
DPANSVRFVDALLLAGGSAYGLAAADGVMRWLEEHRRGVAMDSGVVPIVPGAVIFDLPVG
GWNCRPTADFGYSACAAAGVDVAVGTVGVGVGARAGALKGGVGTASATLQSGVTVGVLAV
VNAAGNVVDPATGLPWMADLVGEFALRAPPAEQIAALAQLSSPLGAFNTPFNTTIGVIAC
DAALSPAACRRIAIAAHDGLARTIRPAHTPLDGDTVFALATGAVAVPPEAGVPAALSPET
QLVTAVGAAAADCLARAVLAGVLNAQPVAGIPTYRDMFPGAFGS
Download sequence
Identical sequences A0A045IT55 A0A083WA76 A0A0H3L973 A0A0H3MCM3 A0A0K2HV21 A0A109SW28 A0A120IWF4 A0A197IZN1 A5U233 F8M6R7 I6YA99 M8CPD8 P64812 P9WM22 P9WM23
gi|479314241|ref|YP_007854293.1| gi|31792529|ref|NP_855022.1| gi|479055297|ref|YP_007351103.1| gi|121637264|ref|YP_977487.1| Rv1333 gi|525674069|ref|YP_008225441.1| gi|506925804|ref|YP_008006254.1| gi|148661122|ref|YP_001282645.1| gi|197740047|ref|YP_002161361.1| gi|224989738|ref|YP_002644425.1| gi|375296860|ref|YP_005101127.1| gi|378771098|ref|YP_005170831.1| 233413.Mb1368 336982.TBFG_11365 410289.BCG_1395 419947.MRA_1341 478434.TBMG_02645 561275.JTY_1369 83331.MT1375 83332.Rv1333 gi|385990760|ref|YP_005909058.1| gi|253799619|ref|YP_003032620.1| gi|383307203|ref|YP_005360014.1| gi|385998118|ref|YP_005916416.1| NP_215849.1.84033 WP_003406908.1.100000 WP_003406908.1.100021 WP_003406908.1.100069 WP_003406908.1.100087 WP_003406908.1.100208 WP_003406908.1.100216 WP_003406908.1.10022 WP_003406908.1.100255 WP_003406908.1.100260 WP_003406908.1.100270 WP_003406908.1.100279 WP_003406908.1.100286 WP_003406908.1.100308 WP_003406908.1.100309 WP_003406908.1.100318 WP_003406908.1.100337 WP_003406908.1.100338 WP_003406908.1.10037 WP_003406908.1.100383 WP_003406908.1.100395 WP_003406908.1.100396 WP_003406908.1.1004 WP_003406908.1.100401 WP_003406908.1.100459 WP_003406908.1.100460 WP_003406908.1.100552 WP_003406908.1.100581 WP_003406908.1.100600 WP_003406908.1.100625 WP_003406908.1.10064 WP_003406908.1.100666 WP_003406908.1.100671 WP_003406908.1.100677 WP_003406908.1.100682 WP_003406908.1.100697 WP_003406908.1.100703 WP_003406908.1.100716 WP_003406908.1.100722 WP_003406908.1.100754 WP_003406908.1.100757 WP_003406908.1.100772 WP_003406908.1.1008 WP_003406908.1.100812 WP_003406908.1.100866 WP_003406908.1.10088 WP_003406908.1.100889 WP_003406908.1.10090 WP_003406908.1.100910 WP_003406908.1.100915 WP_003406908.1.100918 WP_003406908.1.100935 WP_003406908.1.100984 WP_003406908.1.100992 WP_003406908.1.100998 WP_003406908.1.101 WP_003406908.1.101025 WP_003406908.1.101028 WP_003406908.1.10104 WP_003406908.1.101048 WP_003406908.1.101075 WP_003406908.1.101143 WP_003406908.1.101146 WP_003406908.1.10116 WP_003406908.1.10117 WP_003406908.1.101209 WP_003406908.1.10125 WP_003406908.1.101290 WP_003406908.1.101323 WP_003406908.1.101324 WP_003406908.1.101350 WP_003406908.1.101367 WP_003406908.1.101398 WP_003406908.1.101403 WP_003406908.1.101421 WP_003406908.1.10144 WP_003406908.1.101442 WP_003406908.1.10145 WP_003406908.1.101452 WP_003406908.1.101456 WP_003406908.1.101481 WP_003406908.1.101493 WP_003406908.1.101496 WP_003406908.1.101525 WP_003406908.1.101533 WP_003406908.1.101535 WP_003406908.1.101553 WP_003406908.1.101558 WP_003406908.1.10156 WP_003406908.1.101573 WP_003406908.1.101576 WP_003406908.1.10159 WP_003406908.1.101592 WP_003406908.1.101604 WP_003406908.1.101607 WP_003406908.1.101622 WP_003406908.1.101659 WP_003406908.1.101671 WP_003406908.1.101687 WP_003406908.1.101698 WP_003406908.1.10170 WP_003406908.1.101713 WP_003406908.1.101722 WP_003406908.1.101733 WP_003406908.1.101743 WP_003406908.1.101753 WP_003406908.1.101754 WP_003406908.1.101764 WP_003406908.1.101795 WP_003406908.1.101797 WP_003406908.1.101798 WP_003406908.1.101802 WP_003406908.1.101826 WP_003406908.1.101858 WP_003406908.1.101859 WP_003406908.1.101862 WP_003406908.1.101888 WP_003406908.1.101894 WP_003406908.1.101899 WP_003406908.1.1019 WP_003406908.1.101923 WP_003406908.1.101925 WP_003406908.1.10193 WP_003406908.1.101996 WP_003406908.1.102 WP_003406908.1.102008 WP_003406908.1.102017 WP_003406908.1.102053 WP_003406908.1.102055 WP_003406908.1.102063 WP_003406908.1.102099 WP_003406908.1.1021 WP_003406908.1.10211 WP_003406908.1.102121 WP_003406908.1.102143 WP_003406908.1.10216 WP_003406908.1.10224 WP_003406908.1.10253 WP_003406908.1.10262 WP_003406908.1.10272 WP_003406908.1.10277 WP_003406908.1.1033 WP_003406908.1.10350 WP_003406908.1.10362 WP_003406908.1.10366 WP_003406908.1.10376 WP_003406908.1.10396 WP_003406908.1.10410 WP_003406908.1.10414 WP_003406908.1.10421 WP_003406908.1.10430 WP_003406908.1.1044 WP_003406908.1.10440 WP_003406908.1.10445 WP_003406908.1.10471 WP_003406908.1.10472 WP_003406908.1.10489 WP_003406908.1.105 WP_003406908.1.10518 WP_003406908.1.10523 WP_003406908.1.10545 WP_003406908.1.1057 WP_003406908.1.10603 WP_003406908.1.10606 WP_003406908.1.10615 WP_003406908.1.10623 WP_003406908.1.10635 WP_003406908.1.10643 WP_003406908.1.10648 WP_003406908.1.10662 WP_003406908.1.10709 WP_003406908.1.10735 WP_003406908.1.10740 WP_003406908.1.10756 WP_003406908.1.1078 WP_003406908.1.10791 WP_003406908.1.10799 WP_003406908.1.10825 WP_003406908.1.10848 WP_003406908.1.10863 WP_003406908.1.10879 WP_003406908.1.10912 WP_003406908.1.10916 WP_003406908.1.10923 WP_003406908.1.10927 WP_003406908.1.1095 WP_003406908.1.10956 WP_003406908.1.10958 WP_003406908.1.10962 WP_003406908.1.10980 WP_003406908.1.10981 WP_003406908.1.10993 WP_003406908.1.1100 WP_003406908.1.11040 WP_003406908.1.11061 WP_003406908.1.11070 WP_003406908.1.11171 WP_003406908.1.11175 WP_003406908.1.11176 WP_003406908.1.11222 WP_003406908.1.11236 WP_003406908.1.11329 WP_003406908.1.1133 WP_003406908.1.11342 WP_003406908.1.11373 WP_003406908.1.11376 WP_003406908.1.11390 WP_003406908.1.11402 WP_003406908.1.11481 WP_003406908.1.11487 WP_003406908.1.11489 WP_003406908.1.11491 WP_003406908.1.11514 WP_003406908.1.11587 WP_003406908.1.11589 WP_003406908.1.11596 WP_003406908.1.11604 WP_003406908.1.11610 WP_003406908.1.11697 WP_003406908.1.11707 WP_003406908.1.11752 WP_003406908.1.11761 WP_003406908.1.11775 WP_003406908.1.11822 WP_003406908.1.11826 WP_003406908.1.11856 WP_003406908.1.11898 WP_003406908.1.11906 WP_003406908.1.11939 WP_003406908.1.11960 WP_003406908.1.11961 WP_003406908.1.11972 WP_003406908.1.12001 WP_003406908.1.12049 WP_003406908.1.12052 WP_003406908.1.12100 WP_003406908.1.12116 WP_003406908.1.12130 WP_003406908.1.12133 WP_003406908.1.12161 WP_003406908.1.12165 WP_003406908.1.12184 WP_003406908.1.12187 WP_003406908.1.12190 WP_003406908.1.12216 WP_003406908.1.12265 WP_003406908.1.12275 WP_003406908.1.12293 WP_003406908.1.12294 WP_003406908.1.123 WP_003406908.1.1231 WP_003406908.1.12314 WP_003406908.1.12327 WP_003406908.1.12338 WP_003406908.1.1236 WP_003406908.1.12371 WP_003406908.1.12372 WP_003406908.1.12389 WP_003406908.1.12406 WP_003406908.1.1241 WP_003406908.1.12421 WP_003406908.1.12424 WP_003406908.1.12446 WP_003406908.1.12464 WP_003406908.1.12479 WP_003406908.1.12519 WP_003406908.1.12523 WP_003406908.1.12526 WP_003406908.1.1255 WP_003406908.1.12550 WP_003406908.1.12551 WP_003406908.1.12563 WP_003406908.1.12611 WP_003406908.1.12669 WP_003406908.1.1267 WP_003406908.1.12672 WP_003406908.1.12692 WP_003406908.1.1271 WP_003406908.1.12710 WP_003406908.1.12768 WP_003406908.1.1279 WP_003406908.1.12794 WP_003406908.1.12801 WP_003406908.1.12804 WP_003406908.1.12821 WP_003406908.1.12841 WP_003406908.1.12854 WP_003406908.1.12871 WP_003406908.1.12901 WP_003406908.1.12941 WP_003406908.1.12947 WP_003406908.1.12957 WP_003406908.1.12972 WP_003406908.1.13043 WP_003406908.1.13087 WP_003406908.1.13090 WP_003406908.1.13096 WP_003406908.1.13163 WP_003406908.1.13175 WP_003406908.1.13183 WP_003406908.1.132 WP_003406908.1.13249 WP_003406908.1.13282 WP_003406908.1.13284 WP_003406908.1.13296 WP_003406908.1.13298 WP_003406908.1.13302 WP_003406908.1.13306 WP_003406908.1.13312 WP_003406908.1.13313 WP_003406908.1.13321 WP_003406908.1.13345 WP_003406908.1.13358 WP_003406908.1.13370 WP_003406908.1.13375 WP_003406908.1.1338 WP_003406908.1.13420 WP_003406908.1.13433 WP_003406908.1.13435 WP_003406908.1.13461 WP_003406908.1.13466 WP_003406908.1.13489 WP_003406908.1.13526 WP_003406908.1.13579 WP_003406908.1.13647 WP_003406908.1.13687 WP_003406908.1.13697 WP_003406908.1.13719 WP_003406908.1.13763 WP_003406908.1.13774 WP_003406908.1.13793 WP_003406908.1.13794 WP_003406908.1.13817 WP_003406908.1.13834 WP_003406908.1.13866 WP_003406908.1.13880 WP_003406908.1.13899 WP_003406908.1.13909 WP_003406908.1.13910 WP_003406908.1.13919 WP_003406908.1.13920 WP_003406908.1.13952 WP_003406908.1.13953 WP_003406908.1.13962 WP_003406908.1.1398 WP_003406908.1.13988 WP_003406908.1.14027 WP_003406908.1.14046 WP_003406908.1.14115 WP_003406908.1.1415 WP_003406908.1.14152 WP_003406908.1.14158 WP_003406908.1.14162 WP_003406908.1.14175 WP_003406908.1.14178 WP_003406908.1.14194 WP_003406908.1.14195 WP_003406908.1.14208 WP_003406908.1.14238 WP_003406908.1.14266 WP_003406908.1.14273 WP_003406908.1.14303 WP_003406908.1.14306 WP_003406908.1.14307 WP_003406908.1.14310 WP_003406908.1.14341 WP_003406908.1.14382 WP_003406908.1.14416 WP_003406908.1.14428 WP_003406908.1.14441 WP_003406908.1.14469 WP_003406908.1.14477 WP_003406908.1.14504 WP_003406908.1.14514 WP_003406908.1.1452 WP_003406908.1.14527 WP_003406908.1.1454 WP_003406908.1.14544 WP_003406908.1.14548 WP_003406908.1.14551 WP_003406908.1.14561 WP_003406908.1.14573 WP_003406908.1.1462 WP_003406908.1.14658 WP_003406908.1.14667 WP_003406908.1.14668 WP_003406908.1.14675 WP_003406908.1.14694 WP_003406908.1.14695 WP_003406908.1.14709 WP_003406908.1.14766 WP_003406908.1.14783 WP_003406908.1.14865 WP_003406908.1.14905 WP_003406908.1.14926 WP_003406908.1.14951 WP_003406908.1.14955 WP_003406908.1.15003 WP_003406908.1.15009 WP_003406908.1.15028 WP_003406908.1.15040 WP_003406908.1.15052 WP_003406908.1.15065 WP_003406908.1.15072 WP_003406908.1.15089 WP_003406908.1.1509 WP_003406908.1.15126 WP_003406908.1.15131 WP_003406908.1.15168 WP_003406908.1.15174 WP_003406908.1.15196 WP_003406908.1.15210 WP_003406908.1.15216 WP_003406908.1.15217 WP_003406908.1.1523 WP_003406908.1.15232 WP_003406908.1.15238 WP_003406908.1.15240 WP_003406908.1.15253 WP_003406908.1.15267 WP_003406908.1.1527 WP_003406908.1.15292 WP_003406908.1.15299 WP_003406908.1.15302 WP_003406908.1.15322 WP_003406908.1.1534 WP_003406908.1.15345 WP_003406908.1.15365 WP_003406908.1.15372 WP_003406908.1.15386 WP_003406908.1.15387 WP_003406908.1.15442 WP_003406908.1.15447 WP_003406908.1.15449 WP_003406908.1.15477 WP_003406908.1.15481 WP_003406908.1.15492 WP_003406908.1.15511 WP_003406908.1.15512 WP_003406908.1.15558 WP_003406908.1.15559 WP_003406908.1.15566 WP_003406908.1.15599 WP_003406908.1.1560 WP_003406908.1.15611 WP_003406908.1.1563 WP_003406908.1.15633 WP_003406908.1.15643 WP_003406908.1.15688 WP_003406908.1.15755 WP_003406908.1.15763 WP_003406908.1.15774 WP_003406908.1.1578 WP_003406908.1.15834 WP_003406908.1.15842 WP_003406908.1.15853 WP_003406908.1.15870 WP_003406908.1.15877 WP_003406908.1.15893 WP_003406908.1.15896 WP_003406908.1.15926 WP_003406908.1.15933 WP_003406908.1.15946 WP_003406908.1.15958 WP_003406908.1.15973 WP_003406908.1.15987 WP_003406908.1.15993 WP_003406908.1.16025 WP_003406908.1.16043 WP_003406908.1.16055 WP_003406908.1.16066 WP_003406908.1.16069 WP_003406908.1.16077 WP_003406908.1.16106 WP_003406908.1.16108 WP_003406908.1.16110 WP_003406908.1.16130 WP_003406908.1.16136 WP_003406908.1.16139 WP_003406908.1.16141 WP_003406908.1.16143 WP_003406908.1.1630 WP_003406908.1.16318 WP_003406908.1.1632 WP_003406908.1.16327 WP_003406908.1.16334 WP_003406908.1.16341 WP_003406908.1.16345 WP_003406908.1.16374 WP_003406908.1.16384 WP_003406908.1.16386 WP_003406908.1.164 WP_003406908.1.1642 WP_003406908.1.16421 WP_003406908.1.16424 WP_003406908.1.16431 WP_003406908.1.16438 WP_003406908.1.1644 WP_003406908.1.16442 WP_003406908.1.16448 WP_003406908.1.16451 WP_003406908.1.16476 WP_003406908.1.16480 WP_003406908.1.16494 WP_003406908.1.1652 WP_003406908.1.16549 WP_003406908.1.16560 WP_003406908.1.16598 WP_003406908.1.16609 WP_003406908.1.16619 WP_003406908.1.16620 WP_003406908.1.16622 WP_003406908.1.16637 WP_003406908.1.1669 WP_003406908.1.16707 WP_003406908.1.16724 WP_003406908.1.16731 WP_003406908.1.16743 WP_003406908.1.1683 WP_003406908.1.16837 WP_003406908.1.16852 WP_003406908.1.16937 WP_003406908.1.16940 WP_003406908.1.16950 WP_003406908.1.16959 WP_003406908.1.16968 WP_003406908.1.1697 WP_003406908.1.16973 WP_003406908.1.16977 WP_003406908.1.16987 WP_003406908.1.17005 WP_003406908.1.17006 WP_003406908.1.17010 WP_003406908.1.17015 WP_003406908.1.17019 WP_003406908.1.17039 WP_003406908.1.17041 WP_003406908.1.17052 WP_003406908.1.17057 WP_003406908.1.17062 WP_003406908.1.1707 WP_003406908.1.17094 WP_003406908.1.17130 WP_003406908.1.17138 WP_003406908.1.17147 WP_003406908.1.17167 WP_003406908.1.17224 WP_003406908.1.17251 WP_003406908.1.17288 WP_003406908.1.17304 WP_003406908.1.17314 WP_003406908.1.17345 WP_003406908.1.17381 WP_003406908.1.17391 WP_003406908.1.17412 WP_003406908.1.17440 WP_003406908.1.17466 WP_003406908.1.17477 WP_003406908.1.17483 WP_003406908.1.17505 WP_003406908.1.17527 WP_003406908.1.17535 WP_003406908.1.17540 WP_003406908.1.17553 WP_003406908.1.17558 WP_003406908.1.17599 WP_003406908.1.17635 WP_003406908.1.17655 WP_003406908.1.17679 WP_003406908.1.1768 WP_003406908.1.17687 WP_003406908.1.17700 WP_003406908.1.17710 WP_003406908.1.17713 WP_003406908.1.17722 WP_003406908.1.17746 WP_003406908.1.17788 WP_003406908.1.17798 WP_003406908.1.17803 WP_003406908.1.17816 WP_003406908.1.17821 WP_003406908.1.17830 WP_003406908.1.17868 WP_003406908.1.17878 WP_003406908.1.1792 WP_003406908.1.17923 WP_003406908.1.1795 WP_003406908.1.17955 WP_003406908.1.17973 WP_003406908.1.18009 WP_003406908.1.18013 WP_003406908.1.18033 WP_003406908.1.18057 WP_003406908.1.18065 WP_003406908.1.18070 WP_003406908.1.18116 WP_003406908.1.18120 WP_003406908.1.18126 WP_003406908.1.1817 WP_003406908.1.18170 WP_003406908.1.18206 WP_003406908.1.18216 WP_003406908.1.18240 WP_003406908.1.18257 WP_003406908.1.18297 WP_003406908.1.18306 WP_003406908.1.18364 WP_003406908.1.18411 WP_003406908.1.18444 WP_003406908.1.18448 WP_003406908.1.18467 WP_003406908.1.18476 WP_003406908.1.18522 WP_003406908.1.18580 WP_003406908.1.18587 WP_003406908.1.186 WP_003406908.1.18601 WP_003406908.1.18639 WP_003406908.1.18646 WP_003406908.1.18647 WP_003406908.1.1868 WP_003406908.1.18710 WP_003406908.1.18751 WP_003406908.1.18781 WP_003406908.1.18793 WP_003406908.1.18804 WP_003406908.1.18816 WP_003406908.1.18823 WP_003406908.1.18827 WP_003406908.1.18838 WP_003406908.1.18849 WP_003406908.1.18856 WP_003406908.1.18945 WP_003406908.1.1898 WP_003406908.1.19005 WP_003406908.1.19056 WP_003406908.1.19063 WP_003406908.1.19066 WP_003406908.1.19071 WP_003406908.1.19085 WP_003406908.1.19094 WP_003406908.1.19144 WP_003406908.1.19159 WP_003406908.1.19193 WP_003406908.1.19231 WP_003406908.1.19243 WP_003406908.1.19264 WP_003406908.1.19295 WP_003406908.1.19307 WP_003406908.1.19326 WP_003406908.1.1933 WP_003406908.1.19364 WP_003406908.1.19382 WP_003406908.1.19400 WP_003406908.1.19426 WP_003406908.1.19429 WP_003406908.1.19464 WP_003406908.1.19480 WP_003406908.1.19512 WP_003406908.1.19553 WP_003406908.1.19562 WP_003406908.1.19564 WP_003406908.1.19568 WP_003406908.1.19572 WP_003406908.1.19595 WP_003406908.1.19596 WP_003406908.1.19630 WP_003406908.1.1967 WP_003406908.1.19694 WP_003406908.1.1970 WP_003406908.1.19707 WP_003406908.1.19742 WP_003406908.1.19785 WP_003406908.1.19820 WP_003406908.1.19868 WP_003406908.1.19890 WP_003406908.1.19900 WP_003406908.1.19922 WP_003406908.1.19936 WP_003406908.1.19946 WP_003406908.1.19949 WP_003406908.1.19960 WP_003406908.1.19964 WP_003406908.1.20007 WP_003406908.1.20016 WP_003406908.1.20028 WP_003406908.1.2003 WP_003406908.1.20037 WP_003406908.1.20039 WP_003406908.1.20085 WP_003406908.1.20097 WP_003406908.1.20116 WP_003406908.1.20130 WP_003406908.1.20140 WP_003406908.1.20141 WP_003406908.1.20142 WP_003406908.1.20158 WP_003406908.1.20239 WP_003406908.1.20243 WP_003406908.1.20259 WP_003406908.1.20262 WP_003406908.1.20268 WP_003406908.1.20272 WP_003406908.1.20273 WP_003406908.1.20280 WP_003406908.1.20294 WP_003406908.1.20300 WP_003406908.1.20309 WP_003406908.1.20322 WP_003406908.1.2037 WP_003406908.1.20372 WP_003406908.1.20381 WP_003406908.1.204 WP_003406908.1.20427 WP_003406908.1.20432 WP_003406908.1.20457 WP_003406908.1.20459 WP_003406908.1.20460 WP_003406908.1.20542 WP_003406908.1.20578 WP_003406908.1.20608 WP_003406908.1.20624 WP_003406908.1.20628 WP_003406908.1.2066 WP_003406908.1.20707 WP_003406908.1.20722 WP_003406908.1.20729 WP_003406908.1.20742 WP_003406908.1.20751 WP_003406908.1.20776 WP_003406908.1.20843 WP_003406908.1.20850 WP_003406908.1.2086 WP_003406908.1.20868 WP_003406908.1.20876 WP_003406908.1.20897 WP_003406908.1.20898 WP_003406908.1.2090 WP_003406908.1.20916 WP_003406908.1.20921 WP_003406908.1.20926 WP_003406908.1.20927 WP_003406908.1.20970 WP_003406908.1.2104 WP_003406908.1.21127 WP_003406908.1.21135 WP_003406908.1.21173 WP_003406908.1.21187 WP_003406908.1.212 WP_003406908.1.2120 WP_003406908.1.21218 WP_003406908.1.21219 WP_003406908.1.2123 WP_003406908.1.21231 WP_003406908.1.21234 WP_003406908.1.2126 WP_003406908.1.21292 WP_003406908.1.21307 WP_003406908.1.2131 WP_003406908.1.21311 WP_003406908.1.21321 WP_003406908.1.21365 WP_003406908.1.2137 WP_003406908.1.21392 WP_003406908.1.21397 WP_003406908.1.21403 WP_003406908.1.21415 WP_003406908.1.21418 WP_003406908.1.21430 WP_003406908.1.21434 WP_003406908.1.21444 WP_003406908.1.21468 WP_003406908.1.21498 WP_003406908.1.21509 WP_003406908.1.21513 WP_003406908.1.21560 WP_003406908.1.21565 WP_003406908.1.21586 WP_003406908.1.21591 WP_003406908.1.21594 WP_003406908.1.21602 WP_003406908.1.21638 WP_003406908.1.21639 WP_003406908.1.21655 WP_003406908.1.21658 WP_003406908.1.2168 WP_003406908.1.2174 WP_003406908.1.21741 WP_003406908.1.21742 WP_003406908.1.21777 WP_003406908.1.21786 WP_003406908.1.21795 WP_003406908.1.218 WP_003406908.1.21826 WP_003406908.1.21829 WP_003406908.1.21840 WP_003406908.1.21843 WP_003406908.1.21872 WP_003406908.1.21873 WP_003406908.1.2188 WP_003406908.1.21882 WP_003406908.1.21906 WP_003406908.1.21912 WP_003406908.1.2194 WP_003406908.1.21941 WP_003406908.1.21956 WP_003406908.1.21958 WP_003406908.1.21960 WP_003406908.1.21973 WP_003406908.1.21983 WP_003406908.1.22003 WP_003406908.1.22013 WP_003406908.1.22025 WP_003406908.1.22036 WP_003406908.1.22075 WP_003406908.1.22092 WP_003406908.1.2212 WP_003406908.1.22127 WP_003406908.1.22140 WP_003406908.1.22233 WP_003406908.1.22255 WP_003406908.1.22277 WP_003406908.1.22305 WP_003406908.1.22348 WP_003406908.1.22366 WP_003406908.1.2238 WP_003406908.1.22380 WP_003406908.1.22437 WP_003406908.1.22438 WP_003406908.1.22490 WP_003406908.1.22511 WP_003406908.1.22524 WP_003406908.1.2253 WP_003406908.1.22585 WP_003406908.1.22589 WP_003406908.1.22606 WP_003406908.1.22608 WP_003406908.1.22609 WP_003406908.1.22618 WP_003406908.1.2262 WP_003406908.1.22624 WP_003406908.1.22629 WP_003406908.1.22647 WP_003406908.1.22664 WP_003406908.1.22665 WP_003406908.1.22670 WP_003406908.1.22674 WP_003406908.1.22680 WP_003406908.1.22725 WP_003406908.1.22728 WP_003406908.1.22733 WP_003406908.1.22737 WP_003406908.1.2275 WP_003406908.1.22754 WP_003406908.1.22797 WP_003406908.1.22800 WP_003406908.1.22804 WP_003406908.1.22829 WP_003406908.1.22840 WP_003406908.1.22844 WP_003406908.1.22963 WP_003406908.1.22970 WP_003406908.1.22996 WP_003406908.1.22997 WP_003406908.1.22999 WP_003406908.1.23015 WP_003406908.1.23032 WP_003406908.1.231 WP_003406908.1.23101 WP_003406908.1.2312 WP_003406908.1.23140 WP_003406908.1.23153 WP_003406908.1.23171 WP_003406908.1.23199 WP_003406908.1.2320 WP_003406908.1.23204 WP_003406908.1.23216 WP_003406908.1.23229 WP_003406908.1.23233 WP_003406908.1.2326 WP_003406908.1.23261 WP_003406908.1.23272 WP_003406908.1.23289 WP_003406908.1.2329 WP_003406908.1.23308 WP_003406908.1.23316 WP_003406908.1.23321 WP_003406908.1.23325 WP_003406908.1.2339 WP_003406908.1.23406 WP_003406908.1.23438 WP_003406908.1.23445 WP_003406908.1.23447 WP_003406908.1.23452 WP_003406908.1.23461 WP_003406908.1.2349 WP_003406908.1.23496 WP_003406908.1.23497 WP_003406908.1.23506 WP_003406908.1.23530 WP_003406908.1.23539 WP_003406908.1.23546 WP_003406908.1.23551 WP_003406908.1.23573 WP_003406908.1.23583 WP_003406908.1.23588 WP_003406908.1.23628 WP_003406908.1.23677 WP_003406908.1.23683 WP_003406908.1.23692 WP_003406908.1.23694 WP_003406908.1.23699 WP_003406908.1.2371 WP_003406908.1.23803 WP_003406908.1.23807 WP_003406908.1.23825 WP_003406908.1.23832 WP_003406908.1.2384 WP_003406908.1.23843 WP_003406908.1.23863 WP_003406908.1.2387 WP_003406908.1.23894 WP_003406908.1.23993 WP_003406908.1.2400 WP_003406908.1.24007 WP_003406908.1.24008 WP_003406908.1.24046 WP_003406908.1.24057 WP_003406908.1.24062 WP_003406908.1.24113 WP_003406908.1.24119 WP_003406908.1.24128 WP_003406908.1.24140 WP_003406908.1.24176 WP_003406908.1.24190 WP_003406908.1.24202 WP_003406908.1.24244 WP_003406908.1.24261 WP_003406908.1.24284 WP_003406908.1.24294 WP_003406908.1.24357 WP_003406908.1.24396 WP_003406908.1.24414 WP_003406908.1.24423 WP_003406908.1.2443 WP_003406908.1.24446 WP_003406908.1.24461 WP_003406908.1.24500 WP_003406908.1.24507 WP_003406908.1.24509 WP_003406908.1.24529 WP_003406908.1.24553 WP_003406908.1.24599 WP_003406908.1.24629 WP_003406908.1.24638 WP_003406908.1.24648 WP_003406908.1.2466 WP_003406908.1.24767 WP_003406908.1.24824 WP_003406908.1.24831 WP_003406908.1.24840 WP_003406908.1.24848 WP_003406908.1.24857 WP_003406908.1.24893 WP_003406908.1.24933 WP_003406908.1.24956 WP_003406908.1.24958 WP_003406908.1.24985 WP_003406908.1.2499 WP_003406908.1.25004 WP_003406908.1.2505 WP_003406908.1.25051 WP_003406908.1.2507 WP_003406908.1.25129 WP_003406908.1.25171 WP_003406908.1.25184 WP_003406908.1.25247 WP_003406908.1.25252 WP_003406908.1.25278 WP_003406908.1.25283 WP_003406908.1.25309 WP_003406908.1.25313 WP_003406908.1.25338 WP_003406908.1.25342 WP_003406908.1.25343 WP_003406908.1.25367 WP_003406908.1.25393 WP_003406908.1.25406 WP_003406908.1.25435 WP_003406908.1.25437 WP_003406908.1.25445 WP_003406908.1.25455 WP_003406908.1.25473 WP_003406908.1.25504 WP_003406908.1.25542 WP_003406908.1.25579 WP_003406908.1.25606 WP_003406908.1.25645 WP_003406908.1.2566 WP_003406908.1.25673 WP_003406908.1.25674 WP_003406908.1.25693 WP_003406908.1.25699 WP_003406908.1.25727 WP_003406908.1.25736 WP_003406908.1.25738 WP_003406908.1.25756 WP_003406908.1.25759 WP_003406908.1.2580 WP_003406908.1.25813 WP_003406908.1.25853 WP_003406908.1.25854 WP_003406908.1.25874 WP_003406908.1.25885 WP_003406908.1.25892 WP_003406908.1.25906 WP_003406908.1.25914 WP_003406908.1.25916 WP_003406908.1.2594 WP_003406908.1.25954 WP_003406908.1.25965 WP_003406908.1.25972 WP_003406908.1.26017 WP_003406908.1.26032 WP_003406908.1.26038 WP_003406908.1.26072 WP_003406908.1.26089 WP_003406908.1.26097 WP_003406908.1.26098 WP_003406908.1.26108 WP_003406908.1.26109 WP_003406908.1.26118 WP_003406908.1.26126 WP_003406908.1.2614 WP_003406908.1.26168 WP_003406908.1.26182 WP_003406908.1.26190 WP_003406908.1.2620 WP_003406908.1.26234 WP_003406908.1.26243 WP_003406908.1.26265 WP_003406908.1.26267 WP_003406908.1.26292 WP_003406908.1.26310 WP_003406908.1.26328 WP_003406908.1.26349 WP_003406908.1.26366 WP_003406908.1.26407 WP_003406908.1.26412 WP_003406908.1.26454 WP_003406908.1.26464 WP_003406908.1.2653 WP_003406908.1.26560 WP_003406908.1.26571 WP_003406908.1.2659 WP_003406908.1.26597 WP_003406908.1.26603 WP_003406908.1.26629 WP_003406908.1.26651 WP_003406908.1.26702 WP_003406908.1.26707 WP_003406908.1.26710 WP_003406908.1.26719 WP_003406908.1.26737 WP_003406908.1.26738 WP_003406908.1.26745 WP_003406908.1.26756 WP_003406908.1.2676 WP_003406908.1.2677 WP_003406908.1.26779 WP_003406908.1.26780 WP_003406908.1.26798 WP_003406908.1.26854 WP_003406908.1.26868 WP_003406908.1.26876 WP_003406908.1.26888 WP_003406908.1.26914 WP_003406908.1.26945 WP_003406908.1.26959 WP_003406908.1.26969 WP_003406908.1.26984 WP_003406908.1.26992 WP_003406908.1.27004 WP_003406908.1.27017 WP_003406908.1.27045 WP_003406908.1.27074 WP_003406908.1.27075 WP_003406908.1.27128 WP_003406908.1.27130 WP_003406908.1.27139 WP_003406908.1.27152 WP_003406908.1.27162 WP_003406908.1.27164 WP_003406908.1.27193 WP_003406908.1.27235 WP_003406908.1.27254 WP_003406908.1.27278 WP_003406908.1.27343 WP_003406908.1.27352 WP_003406908.1.27369 WP_003406908.1.27391 WP_003406908.1.27398 WP_003406908.1.27402 WP_003406908.1.27410 WP_003406908.1.27411 WP_003406908.1.27449 WP_003406908.1.27460 WP_003406908.1.27463 WP_003406908.1.27492 WP_003406908.1.27528 WP_003406908.1.27541 WP_003406908.1.27576 WP_003406908.1.27582 WP_003406908.1.27596 WP_003406908.1.27607 WP_003406908.1.2766 WP_003406908.1.277 WP_003406908.1.27724 WP_003406908.1.27730 WP_003406908.1.27736 WP_003406908.1.27743 WP_003406908.1.27750 WP_003406908.1.27771 WP_003406908.1.27779 WP_003406908.1.27795 WP_003406908.1.27803 WP_003406908.1.27835 WP_003406908.1.27915 WP_003406908.1.27935 WP_003406908.1.27962 WP_003406908.1.28053 WP_003406908.1.28092 WP_003406908.1.28106 WP_003406908.1.28131 WP_003406908.1.28142 WP_003406908.1.28159 WP_003406908.1.2816 WP_003406908.1.28161 WP_003406908.1.28192 WP_003406908.1.28202 WP_003406908.1.28241 WP_003406908.1.28251 WP_003406908.1.28255 WP_003406908.1.28269 WP_003406908.1.28276 WP_003406908.1.28293 WP_003406908.1.28331 WP_003406908.1.28367 WP_003406908.1.28378 WP_003406908.1.2842 WP_003406908.1.28448 WP_003406908.1.2847 WP_003406908.1.28471 WP_003406908.1.28473 WP_003406908.1.28493 WP_003406908.1.28497 WP_003406908.1.28530 WP_003406908.1.28545 WP_003406908.1.28561 WP_003406908.1.28567 WP_003406908.1.28585 WP_003406908.1.286 WP_003406908.1.28610 WP_003406908.1.28617 WP_003406908.1.28634 WP_003406908.1.28642 WP_003406908.1.28671 WP_003406908.1.28682 WP_003406908.1.28698 WP_003406908.1.28703 WP_003406908.1.28739 WP_003406908.1.28758 WP_003406908.1.28781 WP_003406908.1.28787 WP_003406908.1.28827 WP_003406908.1.28839 WP_003406908.1.28847 WP_003406908.1.28850 WP_003406908.1.28851 WP_003406908.1.28865 WP_003406908.1.28897 WP_003406908.1.28914 WP_003406908.1.28935 WP_003406908.1.28936 WP_003406908.1.28939 WP_003406908.1.28943 WP_003406908.1.28952 WP_003406908.1.28975 WP_003406908.1.2899 WP_003406908.1.28993 WP_003406908.1.29000 WP_003406908.1.2901 WP_003406908.1.29028 WP_003406908.1.29033 WP_003406908.1.29058 WP_003406908.1.29078 WP_003406908.1.29102 WP_003406908.1.29115 WP_003406908.1.2916 WP_003406908.1.29217 WP_003406908.1.29223 WP_003406908.1.29234 WP_003406908.1.29264 WP_003406908.1.29275 WP_003406908.1.29306 WP_003406908.1.29339 WP_003406908.1.29348 WP_003406908.1.29364 WP_003406908.1.29367 WP_003406908.1.2938 WP_003406908.1.29399 WP_003406908.1.29426 WP_003406908.1.2944 WP_003406908.1.29449 WP_003406908.1.29450 WP_003406908.1.29452 WP_003406908.1.2949 WP_003406908.1.29510 WP_003406908.1.29515 WP_003406908.1.29525 WP_003406908.1.2953 WP_003406908.1.29559 WP_003406908.1.29587 WP_003406908.1.2959 WP_003406908.1.29592 WP_003406908.1.29611 WP_003406908.1.29632 WP_003406908.1.29649 WP_003406908.1.2965 WP_003406908.1.29659 WP_003406908.1.2969 WP_003406908.1.29696 WP_003406908.1.29698 WP_003406908.1.29718 WP_003406908.1.29742 WP_003406908.1.29745 WP_003406908.1.29747 WP_003406908.1.29769 WP_003406908.1.29825 WP_003406908.1.29830 WP_003406908.1.29847 WP_003406908.1.29861 WP_003406908.1.29869 WP_003406908.1.29883 WP_003406908.1.29890 WP_003406908.1.299 WP_003406908.1.29931 WP_003406908.1.29960 WP_003406908.1.30014 WP_003406908.1.3004 WP_003406908.1.30040 WP_003406908.1.30043 WP_003406908.1.30074 WP_003406908.1.30097 WP_003406908.1.30101 WP_003406908.1.30106 WP_003406908.1.30114 WP_003406908.1.30126 WP_003406908.1.30131 WP_003406908.1.30138 WP_003406908.1.30139 WP_003406908.1.30145 WP_003406908.1.30211 WP_003406908.1.30224 WP_003406908.1.30235 WP_003406908.1.30237 WP_003406908.1.30279 WP_003406908.1.30282 WP_003406908.1.30283 WP_003406908.1.30288 WP_003406908.1.30291 WP_003406908.1.30363 WP_003406908.1.30374 WP_003406908.1.30404 WP_003406908.1.3043 WP_003406908.1.30433 WP_003406908.1.30438 WP_003406908.1.30462 WP_003406908.1.30464 WP_003406908.1.30468 WP_003406908.1.3057 WP_003406908.1.30574 WP_003406908.1.30628 WP_003406908.1.30641 WP_003406908.1.30642 WP_003406908.1.30661 WP_003406908.1.30669 WP_003406908.1.30683 WP_003406908.1.30699 WP_003406908.1.30709 WP_003406908.1.30713 WP_003406908.1.30716 WP_003406908.1.30719 WP_003406908.1.30732 WP_003406908.1.30736 WP_003406908.1.30760 WP_003406908.1.30791 WP_003406908.1.308 WP_003406908.1.30807 WP_003406908.1.30818 WP_003406908.1.30824 WP_003406908.1.30848 WP_003406908.1.30877 WP_003406908.1.30888 WP_003406908.1.30901 WP_003406908.1.30903 WP_003406908.1.30912 WP_003406908.1.30913 WP_003406908.1.30914 WP_003406908.1.30919 WP_003406908.1.30977 WP_003406908.1.3100 WP_003406908.1.31002 WP_003406908.1.3101 WP_003406908.1.31034 WP_003406908.1.31047 WP_003406908.1.31070 WP_003406908.1.31074 WP_003406908.1.31102 WP_003406908.1.31127 WP_003406908.1.31184 WP_003406908.1.31199 WP_003406908.1.31226 WP_003406908.1.31230 WP_003406908.1.31233 WP_003406908.1.31263 WP_003406908.1.31264 WP_003406908.1.31270 WP_003406908.1.31287 WP_003406908.1.31290 WP_003406908.1.31304 WP_003406908.1.31346 WP_003406908.1.31348 WP_003406908.1.31354 WP_003406908.1.31390 WP_003406908.1.31414 WP_003406908.1.31417 WP_003406908.1.31428 WP_003406908.1.3143 WP_003406908.1.31458 WP_003406908.1.31483 WP_003406908.1.3149 WP_003406908.1.31498 WP_003406908.1.31507 WP_003406908.1.31537 WP_003406908.1.31548 WP_003406908.1.31569 WP_003406908.1.31573 WP_003406908.1.316 WP_003406908.1.31629 WP_003406908.1.31666 WP_003406908.1.31693 WP_003406908.1.31703 WP_003406908.1.31744 WP_003406908.1.31770 WP_003406908.1.31776 WP_003406908.1.31783 WP_003406908.1.318 WP_003406908.1.3184 WP_003406908.1.31840 WP_003406908.1.31880 WP_003406908.1.31911 WP_003406908.1.31930 WP_003406908.1.31932 WP_003406908.1.31955 WP_003406908.1.31985 WP_003406908.1.31991 WP_003406908.1.31995 WP_003406908.1.32004 WP_003406908.1.32039 WP_003406908.1.3204 WP_003406908.1.32045 WP_003406908.1.32071 WP_003406908.1.32098 WP_003406908.1.32132 WP_003406908.1.32164 WP_003406908.1.32179 WP_003406908.1.32198 WP_003406908.1.32297 WP_003406908.1.32317 WP_003406908.1.32383 WP_003406908.1.32400 WP_003406908.1.32403 WP_003406908.1.32416 WP_003406908.1.32421 WP_003406908.1.32433 WP_003406908.1.32461 WP_003406908.1.32482 WP_003406908.1.32503 WP_003406908.1.32556 WP_003406908.1.32562 WP_003406908.1.32569 WP_003406908.1.32592 WP_003406908.1.32620 WP_003406908.1.32647 WP_003406908.1.32653 WP_003406908.1.32654 WP_003406908.1.3268 WP_003406908.1.32695 WP_003406908.1.32706 WP_003406908.1.32716 WP_003406908.1.32738 WP_003406908.1.32780 WP_003406908.1.32781 WP_003406908.1.32793 WP_003406908.1.32799 WP_003406908.1.32822 WP_003406908.1.32833 WP_003406908.1.32862 WP_003406908.1.32880 WP_003406908.1.32897 WP_003406908.1.32909 WP_003406908.1.32935 WP_003406908.1.32974 WP_003406908.1.3302 WP_003406908.1.33028 WP_003406908.1.33035 WP_003406908.1.33044 WP_003406908.1.33054 WP_003406908.1.33082 WP_003406908.1.33141 WP_003406908.1.33148 WP_003406908.1.33155 WP_003406908.1.33168 WP_003406908.1.3321 WP_003406908.1.33215 WP_003406908.1.3325 WP_003406908.1.3327 WP_003406908.1.33278 WP_003406908.1.33288 WP_003406908.1.33305 WP_003406908.1.3331 WP_003406908.1.33319 WP_003406908.1.3333 WP_003406908.1.33393 WP_003406908.1.33403 WP_003406908.1.33452 WP_003406908.1.33467 WP_003406908.1.33477 WP_003406908.1.33519 WP_003406908.1.33542 WP_003406908.1.33601 WP_003406908.1.33602 WP_003406908.1.33633 WP_003406908.1.33646 WP_003406908.1.33673 WP_003406908.1.3369 WP_003406908.1.33705 WP_003406908.1.33762 WP_003406908.1.33783 WP_003406908.1.33789 WP_003406908.1.3383 WP_003406908.1.33832 WP_003406908.1.33848 WP_003406908.1.3387 WP_003406908.1.33886 WP_003406908.1.33895 WP_003406908.1.33906 WP_003406908.1.33912 WP_003406908.1.33954 WP_003406908.1.3399 WP_003406908.1.34042 WP_003406908.1.3405 WP_003406908.1.34055 WP_003406908.1.34056 WP_003406908.1.34065 WP_003406908.1.3408 WP_003406908.1.34090 WP_003406908.1.34109 WP_003406908.1.34111 WP_003406908.1.34131 WP_003406908.1.34152 WP_003406908.1.34153 WP_003406908.1.34163 WP_003406908.1.34181 WP_003406908.1.34197 WP_003406908.1.34198 WP_003406908.1.34215 WP_003406908.1.34219 WP_003406908.1.34255 WP_003406908.1.34260 WP_003406908.1.34275 WP_003406908.1.343 WP_003406908.1.34347 WP_003406908.1.34358 WP_003406908.1.34392 WP_003406908.1.344 WP_003406908.1.34428 WP_003406908.1.3443 WP_003406908.1.34435 WP_003406908.1.34446 WP_003406908.1.34499 WP_003406908.1.34505 WP_003406908.1.34516 WP_003406908.1.34529 WP_003406908.1.34551 WP_003406908.1.34563 WP_003406908.1.34581 WP_003406908.1.34588 WP_003406908.1.34596 WP_003406908.1.34599 WP_003406908.1.34639 WP_003406908.1.34673 WP_003406908.1.34724 WP_003406908.1.34740 WP_003406908.1.34755 WP_003406908.1.34777 WP_003406908.1.34783 WP_003406908.1.34841 WP_003406908.1.34908 WP_003406908.1.34919 WP_003406908.1.3492 WP_003406908.1.34933 WP_003406908.1.34945 WP_003406908.1.34946 WP_003406908.1.34954 WP_003406908.1.34960 WP_003406908.1.34961 WP_003406908.1.34963 WP_003406908.1.34965 WP_003406908.1.34968 WP_003406908.1.35023 WP_003406908.1.35069 WP_003406908.1.35072 WP_003406908.1.35078 WP_003406908.1.35100 WP_003406908.1.35146 WP_003406908.1.35156 WP_003406908.1.35160 WP_003406908.1.35162 WP_003406908.1.35173 WP_003406908.1.35176 WP_003406908.1.3520 WP_003406908.1.35213 WP_003406908.1.35221 WP_003406908.1.35246 WP_003406908.1.35278 WP_003406908.1.35301 WP_003406908.1.35311 WP_003406908.1.35312 WP_003406908.1.35317 WP_003406908.1.35319 WP_003406908.1.35347 WP_003406908.1.35363 WP_003406908.1.35382 WP_003406908.1.35385 WP_003406908.1.35396 WP_003406908.1.35397 WP_003406908.1.35426 WP_003406908.1.35439 WP_003406908.1.35455 WP_003406908.1.3548 WP_003406908.1.35484 WP_003406908.1.35492 WP_003406908.1.3553 WP_003406908.1.35553 WP_003406908.1.35555 WP_003406908.1.35561 WP_003406908.1.35602 WP_003406908.1.35610 WP_003406908.1.35635 WP_003406908.1.35657 WP_003406908.1.35680 WP_003406908.1.35687 WP_003406908.1.35689 WP_003406908.1.35707 WP_003406908.1.35732 WP_003406908.1.35754 WP_003406908.1.35767 WP_003406908.1.35770 WP_003406908.1.35771 WP_003406908.1.35780 WP_003406908.1.35805 WP_003406908.1.35811 WP_003406908.1.35821 WP_003406908.1.3584 WP_003406908.1.35848 WP_003406908.1.35864 WP_003406908.1.35874 WP_003406908.1.35876 WP_003406908.1.35897 WP_003406908.1.35899 WP_003406908.1.35923 WP_003406908.1.3593 WP_003406908.1.35954 WP_003406908.1.36014 WP_003406908.1.36023 WP_003406908.1.36051 WP_003406908.1.36053 WP_003406908.1.36075 WP_003406908.1.36089 WP_003406908.1.36097 WP_003406908.1.36098 WP_003406908.1.36116 WP_003406908.1.36145 WP_003406908.1.36156 WP_003406908.1.36205 WP_003406908.1.36228 WP_003406908.1.36246 WP_003406908.1.36252 WP_003406908.1.36260 WP_003406908.1.36270 WP_003406908.1.36271 WP_003406908.1.36303 WP_003406908.1.36309 WP_003406908.1.36315 WP_003406908.1.36319 WP_003406908.1.36321 WP_003406908.1.36326 WP_003406908.1.3634 WP_003406908.1.36356 WP_003406908.1.36357 WP_003406908.1.3636 WP_003406908.1.36385 WP_003406908.1.36399 WP_003406908.1.36436 WP_003406908.1.36465 WP_003406908.1.36469 WP_003406908.1.36473 WP_003406908.1.36485 WP_003406908.1.36508 WP_003406908.1.36540 WP_003406908.1.36561 WP_003406908.1.36571 WP_003406908.1.36573 WP_003406908.1.36578 WP_003406908.1.36585 WP_003406908.1.36597 WP_003406908.1.36614 WP_003406908.1.36657 WP_003406908.1.36674 WP_003406908.1.36720 WP_003406908.1.36727 WP_003406908.1.36733 WP_003406908.1.36810 WP_003406908.1.36844 WP_003406908.1.36851 WP_003406908.1.36862 WP_003406908.1.36893 WP_003406908.1.36901 WP_003406908.1.36921 WP_003406908.1.36935 WP_003406908.1.36941 WP_003406908.1.3695 WP_003406908.1.36951 WP_003406908.1.36968 WP_003406908.1.3700 WP_003406908.1.37004 WP_003406908.1.37012 WP_003406908.1.37071 WP_003406908.1.37088 WP_003406908.1.37131 WP_003406908.1.37157 WP_003406908.1.37175 WP_003406908.1.37188 WP_003406908.1.37213 WP_003406908.1.37229 WP_003406908.1.3724 WP_003406908.1.37277 WP_003406908.1.37305 WP_003406908.1.37330 WP_003406908.1.37389 WP_003406908.1.37400 WP_003406908.1.37440 WP_003406908.1.37459 WP_003406908.1.37468 WP_003406908.1.37475 WP_003406908.1.37484 WP_003406908.1.37601 WP_003406908.1.37612 WP_003406908.1.37632 WP_003406908.1.37643 WP_003406908.1.37655 WP_003406908.1.37660 WP_003406908.1.37674 WP_003406908.1.37700 WP_003406908.1.37701 WP_003406908.1.37709 WP_003406908.1.37711 WP_003406908.1.37721 WP_003406908.1.37722 WP_003406908.1.37747 WP_003406908.1.37765 WP_003406908.1.37772 WP_003406908.1.37804 WP_003406908.1.37809 WP_003406908.1.37859 WP_003406908.1.37877 WP_003406908.1.37912 WP_003406908.1.37913 WP_003406908.1.37943 WP_003406908.1.37950 WP_003406908.1.37973 WP_003406908.1.37975 WP_003406908.1.37983 WP_003406908.1.38 WP_003406908.1.38002 WP_003406908.1.3802 WP_003406908.1.38039 WP_003406908.1.38040 WP_003406908.1.38067 WP_003406908.1.38068 WP_003406908.1.38135 WP_003406908.1.38138 WP_003406908.1.38144 WP_003406908.1.38158 WP_003406908.1.38159 WP_003406908.1.38210 WP_003406908.1.38233 WP_003406908.1.38240 WP_003406908.1.38299 WP_003406908.1.38332 WP_003406908.1.38347 WP_003406908.1.38354 WP_003406908.1.38380 WP_003406908.1.38384 WP_003406908.1.38389 WP_003406908.1.38398 WP_003406908.1.38402 WP_003406908.1.38418 WP_003406908.1.38421 WP_003406908.1.38466 WP_003406908.1.38477 WP_003406908.1.38483 WP_003406908.1.3849 WP_003406908.1.385 WP_003406908.1.38530 WP_003406908.1.38535 WP_003406908.1.38539 WP_003406908.1.38594 WP_003406908.1.38601 WP_003406908.1.38611 WP_003406908.1.38638 WP_003406908.1.38639 WP_003406908.1.38646 WP_003406908.1.38648 WP_003406908.1.38654 WP_003406908.1.38659 WP_003406908.1.38660 WP_003406908.1.38666 WP_003406908.1.38671 WP_003406908.1.38672 WP_003406908.1.38750 WP_003406908.1.38772 WP_003406908.1.38812 WP_003406908.1.38821 WP_003406908.1.38844 WP_003406908.1.38863 WP_003406908.1.38865 WP_003406908.1.38873 WP_003406908.1.3889 WP_003406908.1.38894 WP_003406908.1.38909 WP_003406908.1.38974 WP_003406908.1.38975 WP_003406908.1.38991 WP_003406908.1.39025 WP_003406908.1.39070 WP_003406908.1.39072 WP_003406908.1.39095 WP_003406908.1.39106 WP_003406908.1.39165 WP_003406908.1.39174 WP_003406908.1.39176 WP_003406908.1.39178 WP_003406908.1.39190 WP_003406908.1.39201 WP_003406908.1.39207 WP_003406908.1.39211 WP_003406908.1.39236 WP_003406908.1.39239 WP_003406908.1.39252 WP_003406908.1.39288 WP_003406908.1.39295 WP_003406908.1.39306 WP_003406908.1.39359 WP_003406908.1.39364 WP_003406908.1.39400 WP_003406908.1.39447 WP_003406908.1.3945 WP_003406908.1.39450 WP_003406908.1.39455 WP_003406908.1.3949 WP_003406908.1.39521 WP_003406908.1.39560 WP_003406908.1.39592 WP_003406908.1.39593 WP_003406908.1.396 WP_003406908.1.3960 WP_003406908.1.39616 WP_003406908.1.39654 WP_003406908.1.39657 WP_003406908.1.39661 WP_003406908.1.39674 WP_003406908.1.39678 WP_003406908.1.3968 WP_003406908.1.39694 WP_003406908.1.3971 WP_003406908.1.39718 WP_003406908.1.39728 WP_003406908.1.39739 WP_003406908.1.39748 WP_003406908.1.39751 WP_003406908.1.39759 WP_003406908.1.39801 WP_003406908.1.39804 WP_003406908.1.39848 WP_003406908.1.39877 WP_003406908.1.39925 WP_003406908.1.3994 WP_003406908.1.39959 WP_003406908.1.3996 WP_003406908.1.39960 WP_003406908.1.3997 WP_003406908.1.39980 WP_003406908.1.40000 WP_003406908.1.40028 WP_003406908.1.40029 WP_003406908.1.4003 WP_003406908.1.40094 WP_003406908.1.40096 WP_003406908.1.40150 WP_003406908.1.40156 WP_003406908.1.40174 WP_003406908.1.40186 WP_003406908.1.40276 WP_003406908.1.40277 WP_003406908.1.40323 WP_003406908.1.40336 WP_003406908.1.40353 WP_003406908.1.40372 WP_003406908.1.40402 WP_003406908.1.40413 WP_003406908.1.40440 WP_003406908.1.40446 WP_003406908.1.40451 WP_003406908.1.40455 WP_003406908.1.40523 WP_003406908.1.40543 WP_003406908.1.40641 WP_003406908.1.40646 WP_003406908.1.40651 WP_003406908.1.40653 WP_003406908.1.4067 WP_003406908.1.40705 WP_003406908.1.40723 WP_003406908.1.40731 WP_003406908.1.40735 WP_003406908.1.40799 WP_003406908.1.40852 WP_003406908.1.40876 WP_003406908.1.40881 WP_003406908.1.40922 WP_003406908.1.40948 WP_003406908.1.4095 WP_003406908.1.40956 WP_003406908.1.40957 WP_003406908.1.40964 WP_003406908.1.4097 WP_003406908.1.410 WP_003406908.1.41000 WP_003406908.1.41055 WP_003406908.1.41108 WP_003406908.1.41123 WP_003406908.1.41177 WP_003406908.1.41202 WP_003406908.1.41219 WP_003406908.1.41231 WP_003406908.1.41249 WP_003406908.1.4127 WP_003406908.1.41296 WP_003406908.1.41355 WP_003406908.1.41376 WP_003406908.1.41430 WP_003406908.1.41447 WP_003406908.1.41469 WP_003406908.1.41504 WP_003406908.1.41553 WP_003406908.1.41564 WP_003406908.1.41583 WP_003406908.1.41616 WP_003406908.1.41632 WP_003406908.1.41635 WP_003406908.1.41636 WP_003406908.1.41648 WP_003406908.1.41660 WP_003406908.1.41685 WP_003406908.1.41695 WP_003406908.1.41704 WP_003406908.1.4171 WP_003406908.1.41719 WP_003406908.1.41733 WP_003406908.1.41744 WP_003406908.1.41774 WP_003406908.1.41791 WP_003406908.1.41803 WP_003406908.1.41820 WP_003406908.1.41828 WP_003406908.1.41829 WP_003406908.1.41860 WP_003406908.1.41912 WP_003406908.1.41921 WP_003406908.1.41933 WP_003406908.1.42043 WP_003406908.1.42075 WP_003406908.1.42078 WP_003406908.1.42094 WP_003406908.1.42112 WP_003406908.1.4212 WP_003406908.1.42122 WP_003406908.1.42134 WP_003406908.1.42183 WP_003406908.1.42188 WP_003406908.1.42201 WP_003406908.1.42202 WP_003406908.1.42208 WP_003406908.1.42247 WP_003406908.1.42255 WP_003406908.1.42273 WP_003406908.1.42278 WP_003406908.1.42304 WP_003406908.1.42309 WP_003406908.1.42370 WP_003406908.1.42385 WP_003406908.1.42400 WP_003406908.1.42409 WP_003406908.1.42414 WP_003406908.1.42417 WP_003406908.1.42430 WP_003406908.1.42461 WP_003406908.1.42465 WP_003406908.1.42467 WP_003406908.1.42473 WP_003406908.1.42474 WP_003406908.1.4248 WP_003406908.1.42494 WP_003406908.1.42519 WP_003406908.1.42524 WP_003406908.1.42534 WP_003406908.1.4255 WP_003406908.1.42562 WP_003406908.1.42568 WP_003406908.1.42570 WP_003406908.1.42618 WP_003406908.1.42660 WP_003406908.1.42695 WP_003406908.1.42704 WP_003406908.1.42705 WP_003406908.1.42722 WP_003406908.1.42777 WP_003406908.1.42782 WP_003406908.1.42839 WP_003406908.1.42842 WP_003406908.1.42905 WP_003406908.1.42916 WP_003406908.1.42930 WP_003406908.1.42971 WP_003406908.1.43005 WP_003406908.1.43009 WP_003406908.1.43053 WP_003406908.1.43082 WP_003406908.1.43087 WP_003406908.1.43098 WP_003406908.1.43208 WP_003406908.1.43236 WP_003406908.1.43246 WP_003406908.1.43255 WP_003406908.1.43266 WP_003406908.1.43269 WP_003406908.1.43273 WP_003406908.1.43296 WP_003406908.1.43306 WP_003406908.1.4335 WP_003406908.1.43368 WP_003406908.1.43395 WP_003406908.1.43457 WP_003406908.1.43475 WP_003406908.1.43478 WP_003406908.1.43484 WP_003406908.1.43557 WP_003406908.1.43578 WP_003406908.1.43588 WP_003406908.1.43643 WP_003406908.1.43664 WP_003406908.1.43684 WP_003406908.1.43686 WP_003406908.1.43706 WP_003406908.1.43716 WP_003406908.1.4377 WP_003406908.1.43781 WP_003406908.1.43794 WP_003406908.1.43815 WP_003406908.1.43846 WP_003406908.1.43861 WP_003406908.1.43863 WP_003406908.1.43866 WP_003406908.1.43872 WP_003406908.1.43885 WP_003406908.1.43897 WP_003406908.1.4390 WP_003406908.1.43902 WP_003406908.1.43921 WP_003406908.1.43936 WP_003406908.1.43937 WP_003406908.1.43960 WP_003406908.1.43965 WP_003406908.1.4399 WP_003406908.1.43993 WP_003406908.1.43996 WP_003406908.1.44 WP_003406908.1.44001 WP_003406908.1.44008 WP_003406908.1.44016 WP_003406908.1.44033 WP_003406908.1.44037 WP_003406908.1.44041 WP_003406908.1.44070 WP_003406908.1.44071 WP_003406908.1.44076 WP_003406908.1.44104 WP_003406908.1.44111 WP_003406908.1.44124 WP_003406908.1.44169 WP_003406908.1.44219 WP_003406908.1.44237 WP_003406908.1.44277 WP_003406908.1.44279 WP_003406908.1.44336 WP_003406908.1.44355 WP_003406908.1.4438 WP_003406908.1.44390 WP_003406908.1.44392 WP_003406908.1.4441 WP_003406908.1.44415 WP_003406908.1.44464 WP_003406908.1.44466 WP_003406908.1.44489 WP_003406908.1.44492 WP_003406908.1.44494 WP_003406908.1.44500 WP_003406908.1.44526 WP_003406908.1.44532 WP_003406908.1.44534 WP_003406908.1.44562 WP_003406908.1.44589 WP_003406908.1.44597 WP_003406908.1.44600 WP_003406908.1.44602 WP_003406908.1.44615 WP_003406908.1.4464 WP_003406908.1.44651 WP_003406908.1.44659 WP_003406908.1.44665 WP_003406908.1.44694 WP_003406908.1.44700 WP_003406908.1.44713 WP_003406908.1.44735 WP_003406908.1.44740 WP_003406908.1.44757 WP_003406908.1.4476 WP_003406908.1.44761 WP_003406908.1.44776 WP_003406908.1.44779 WP_003406908.1.44786 WP_003406908.1.44808 WP_003406908.1.44864 WP_003406908.1.44901 WP_003406908.1.44908 WP_003406908.1.44913 WP_003406908.1.4492 WP_003406908.1.44939 WP_003406908.1.44979 WP_003406908.1.44981 WP_003406908.1.45002 WP_003406908.1.45011 WP_003406908.1.4504 WP_003406908.1.45066 WP_003406908.1.45081 WP_003406908.1.45113 WP_003406908.1.45129 WP_003406908.1.45135 WP_003406908.1.45147 WP_003406908.1.45168 WP_003406908.1.4517 WP_003406908.1.45185 WP_003406908.1.45192 WP_003406908.1.45200 WP_003406908.1.45205 WP_003406908.1.45211 WP_003406908.1.45249 WP_003406908.1.4526 WP_003406908.1.45286 WP_003406908.1.45326 WP_003406908.1.45347 WP_003406908.1.45374 WP_003406908.1.45390 WP_003406908.1.454 WP_003406908.1.45407 WP_003406908.1.45451 WP_003406908.1.45453 WP_003406908.1.45460 WP_003406908.1.45463 WP_003406908.1.45470 WP_003406908.1.45474 WP_003406908.1.45491 WP_003406908.1.45510 WP_003406908.1.45563 WP_003406908.1.45584 WP_003406908.1.45590 WP_003406908.1.45619 WP_003406908.1.45626 WP_003406908.1.45631 WP_003406908.1.45666 WP_003406908.1.45697 WP_003406908.1.4571 WP_003406908.1.45731 WP_003406908.1.45743 WP_003406908.1.45765 WP_003406908.1.45776 WP_003406908.1.45783 WP_003406908.1.45805 WP_003406908.1.45815 WP_003406908.1.45849 WP_003406908.1.45867 WP_003406908.1.45884 WP_003406908.1.4590 WP_003406908.1.45923 WP_003406908.1.45963 WP_003406908.1.45989 WP_003406908.1.45992 WP_003406908.1.46025 WP_003406908.1.46083 WP_003406908.1.46090 WP_003406908.1.46092 WP_003406908.1.46100 WP_003406908.1.46101 WP_003406908.1.46103 WP_003406908.1.46107 WP_003406908.1.46127 WP_003406908.1.46128 WP_003406908.1.46129 WP_003406908.1.46141 WP_003406908.1.46150 WP_003406908.1.46201 WP_003406908.1.46226 WP_003406908.1.4624 WP_003406908.1.46253 WP_003406908.1.46268 WP_003406908.1.46285 WP_003406908.1.46300 WP_003406908.1.46313 WP_003406908.1.46336 WP_003406908.1.46370 WP_003406908.1.46381 WP_003406908.1.46402 WP_003406908.1.46411 WP_003406908.1.4644 WP_003406908.1.46442 WP_003406908.1.46463 WP_003406908.1.46478 WP_003406908.1.46492 WP_003406908.1.46521 WP_003406908.1.4653 WP_003406908.1.46532 WP_003406908.1.46539 WP_003406908.1.46568 WP_003406908.1.46585 WP_003406908.1.46609 WP_003406908.1.46613 WP_003406908.1.46625 WP_003406908.1.46642 WP_003406908.1.46647 WP_003406908.1.46674 WP_003406908.1.46724 WP_003406908.1.46758 WP_003406908.1.46773 WP_003406908.1.46777 WP_003406908.1.46786 WP_003406908.1.46792 WP_003406908.1.46847 WP_003406908.1.46851 WP_003406908.1.4687 WP_003406908.1.46897 WP_003406908.1.46936 WP_003406908.1.46980 WP_003406908.1.47011 WP_003406908.1.47012 WP_003406908.1.47066 WP_003406908.1.47077 WP_003406908.1.47083 WP_003406908.1.47106 WP_003406908.1.47142 WP_003406908.1.47147 WP_003406908.1.47166 WP_003406908.1.47178 WP_003406908.1.47179 WP_003406908.1.47194 WP_003406908.1.47207 WP_003406908.1.47210 WP_003406908.1.47261 WP_003406908.1.47262 WP_003406908.1.47402 WP_003406908.1.47423 WP_003406908.1.47467 WP_003406908.1.47502 WP_003406908.1.4751 WP_003406908.1.47511 WP_003406908.1.47537 WP_003406908.1.47540 WP_003406908.1.47568 WP_003406908.1.47572 WP_003406908.1.47588 WP_003406908.1.47636 WP_003406908.1.4764 WP_003406908.1.47679 WP_003406908.1.47681 WP_003406908.1.47690 WP_003406908.1.47717 WP_003406908.1.47743 WP_003406908.1.47754 WP_003406908.1.47773 WP_003406908.1.47776 WP_003406908.1.47780 WP_003406908.1.47805 WP_003406908.1.47832 WP_003406908.1.47847 WP_003406908.1.47858 WP_003406908.1.47868 WP_003406908.1.47893 WP_003406908.1.47899 WP_003406908.1.479 WP_003406908.1.47912 WP_003406908.1.47913 WP_003406908.1.47926 WP_003406908.1.4794 WP_003406908.1.47943 WP_003406908.1.47944 WP_003406908.1.47959 WP_003406908.1.47974 WP_003406908.1.47993 WP_003406908.1.48004 WP_003406908.1.48039 WP_003406908.1.48050 WP_003406908.1.48084 WP_003406908.1.48097 WP_003406908.1.48101 WP_003406908.1.48109 WP_003406908.1.4813 WP_003406908.1.48130 WP_003406908.1.48135 WP_003406908.1.48143 WP_003406908.1.48152 WP_003406908.1.48155 WP_003406908.1.48170 WP_003406908.1.48173 WP_003406908.1.48177 WP_003406908.1.48185 WP_003406908.1.48204 WP_003406908.1.48219 WP_003406908.1.4823 WP_003406908.1.48240 WP_003406908.1.48256 WP_003406908.1.48264 WP_003406908.1.48287 WP_003406908.1.48330 WP_003406908.1.48333 WP_003406908.1.48348 WP_003406908.1.48354 WP_003406908.1.48372 WP_003406908.1.48383 WP_003406908.1.48388 WP_003406908.1.48419 WP_003406908.1.48423 WP_003406908.1.48443 WP_003406908.1.48450 WP_003406908.1.48462 WP_003406908.1.48543 WP_003406908.1.48550 WP_003406908.1.48605 WP_003406908.1.48618 WP_003406908.1.4863 WP_003406908.1.48648 WP_003406908.1.48658 WP_003406908.1.48666 WP_003406908.1.48687 WP_003406908.1.48779 WP_003406908.1.4878 WP_003406908.1.48798 WP_003406908.1.48802 WP_003406908.1.48826 WP_003406908.1.48831 WP_003406908.1.48843 WP_003406908.1.48857 WP_003406908.1.4890 WP_003406908.1.48946 WP_003406908.1.48979 WP_003406908.1.49017 WP_003406908.1.49048 WP_003406908.1.49059 WP_003406908.1.4906 WP_003406908.1.4907 WP_003406908.1.49103 WP_003406908.1.49110 WP_003406908.1.49111 WP_003406908.1.49112 WP_003406908.1.4919 WP_003406908.1.49251 WP_003406908.1.49254 WP_003406908.1.49263 WP_003406908.1.49291 WP_003406908.1.49296 WP_003406908.1.49335 WP_003406908.1.49337 WP_003406908.1.49419 WP_003406908.1.49426 WP_003406908.1.49437 WP_003406908.1.49439 WP_003406908.1.49506 WP_003406908.1.49516 WP_003406908.1.49523 WP_003406908.1.49526 WP_003406908.1.49532 WP_003406908.1.49588 WP_003406908.1.4959 WP_003406908.1.49678 WP_003406908.1.49687 WP_003406908.1.49699 WP_003406908.1.49709 WP_003406908.1.4971 WP_003406908.1.4972 WP_003406908.1.49736 WP_003406908.1.49746 WP_003406908.1.49764 WP_003406908.1.49773 WP_003406908.1.49796 WP_003406908.1.49814 WP_003406908.1.49815 WP_003406908.1.49816 WP_003406908.1.49839 WP_003406908.1.49857 WP_003406908.1.49878 WP_003406908.1.49880 WP_003406908.1.49944 WP_003406908.1.4999 WP_003406908.1.49990 WP_003406908.1.50068 WP_003406908.1.50077 WP_003406908.1.5008 WP_003406908.1.50081 WP_003406908.1.50122 WP_003406908.1.50126 WP_003406908.1.50149 WP_003406908.1.50162 WP_003406908.1.5018 WP_003406908.1.50194 WP_003406908.1.50218 WP_003406908.1.50235 WP_003406908.1.50249 WP_003406908.1.50265 WP_003406908.1.50271 WP_003406908.1.50324 WP_003406908.1.50347 WP_003406908.1.50372 WP_003406908.1.50398 WP_003406908.1.50407 WP_003406908.1.50444 WP_003406908.1.50466 WP_003406908.1.50472 WP_003406908.1.5048 WP_003406908.1.50498 WP_003406908.1.5050 WP_003406908.1.50540 WP_003406908.1.50554 WP_003406908.1.50557 WP_003406908.1.50601 WP_003406908.1.50610 WP_003406908.1.50632 WP_003406908.1.50633 WP_003406908.1.50642 WP_003406908.1.50655 WP_003406908.1.50659 WP_003406908.1.50683 WP_003406908.1.50689 WP_003406908.1.50692 WP_003406908.1.50714 WP_003406908.1.50729 WP_003406908.1.50756 WP_003406908.1.50784 WP_003406908.1.50794 WP_003406908.1.50841 WP_003406908.1.50860 WP_003406908.1.50868 WP_003406908.1.50877 WP_003406908.1.5096 WP_003406908.1.50981 WP_003406908.1.50987 WP_003406908.1.51003 WP_003406908.1.51009 WP_003406908.1.51037 WP_003406908.1.51074 WP_003406908.1.51101 WP_003406908.1.51116 WP_003406908.1.51149 WP_003406908.1.51156 WP_003406908.1.51157 WP_003406908.1.51213 WP_003406908.1.51232 WP_003406908.1.51239 WP_003406908.1.51247 WP_003406908.1.51279 WP_003406908.1.51291 WP_003406908.1.51294 WP_003406908.1.51301 WP_003406908.1.51329 WP_003406908.1.51391 WP_003406908.1.51422 WP_003406908.1.51445 WP_003406908.1.51455 WP_003406908.1.51466 WP_003406908.1.51468 WP_003406908.1.51478 WP_003406908.1.51497 WP_003406908.1.51520 WP_003406908.1.51593 WP_003406908.1.51628 WP_003406908.1.5164 WP_003406908.1.51647 WP_003406908.1.51660 WP_003406908.1.51696 WP_003406908.1.51721 WP_003406908.1.51788 WP_003406908.1.51795 WP_003406908.1.51801 WP_003406908.1.51819 WP_003406908.1.51854 WP_003406908.1.51923 WP_003406908.1.51942 WP_003406908.1.51948 WP_003406908.1.51963 WP_003406908.1.51969 WP_003406908.1.52000 WP_003406908.1.52001 WP_003406908.1.52003 WP_003406908.1.52006 WP_003406908.1.52036 WP_003406908.1.52038 WP_003406908.1.52046 WP_003406908.1.52059 WP_003406908.1.52069 WP_003406908.1.52082 WP_003406908.1.52102 WP_003406908.1.52106 WP_003406908.1.52166 WP_003406908.1.52168 WP_003406908.1.52173 WP_003406908.1.52178 WP_003406908.1.52206 WP_003406908.1.52216 WP_003406908.1.52238 WP_003406908.1.52241 WP_003406908.1.52280 WP_003406908.1.52314 WP_003406908.1.52385 WP_003406908.1.52390 WP_003406908.1.524 WP_003406908.1.52460 WP_003406908.1.52485 WP_003406908.1.52486 WP_003406908.1.52504 WP_003406908.1.52522 WP_003406908.1.52533 WP_003406908.1.52553 WP_003406908.1.52563 WP_003406908.1.52564 WP_003406908.1.52574 WP_003406908.1.52641 WP_003406908.1.52673 WP_003406908.1.52674 WP_003406908.1.52708 WP_003406908.1.52713 WP_003406908.1.52761 WP_003406908.1.52778 WP_003406908.1.52791 WP_003406908.1.52797 WP_003406908.1.52818 WP_003406908.1.52872 WP_003406908.1.52873 WP_003406908.1.52891 WP_003406908.1.52892 WP_003406908.1.52909 WP_003406908.1.52970 WP_003406908.1.53053 WP_003406908.1.53056 WP_003406908.1.5306 WP_003406908.1.53088 WP_003406908.1.5309 WP_003406908.1.531 WP_003406908.1.53117 WP_003406908.1.53118 WP_003406908.1.53142 WP_003406908.1.53143 WP_003406908.1.53157 WP_003406908.1.53167 WP_003406908.1.53200 WP_003406908.1.53204 WP_003406908.1.53213 WP_003406908.1.53217 WP_003406908.1.53226 WP_003406908.1.53229 WP_003406908.1.53230 WP_003406908.1.53237 WP_003406908.1.53254 WP_003406908.1.53257 WP_003406908.1.53276 WP_003406908.1.53278 WP_003406908.1.533 WP_003406908.1.53302 WP_003406908.1.53306 WP_003406908.1.5334 WP_003406908.1.5335 WP_003406908.1.53353 WP_003406908.1.53381 WP_003406908.1.53413 WP_003406908.1.53458 WP_003406908.1.53460 WP_003406908.1.53480 WP_003406908.1.53517 WP_003406908.1.53522 WP_003406908.1.53525 WP_003406908.1.53526 WP_003406908.1.53553 WP_003406908.1.53606 WP_003406908.1.53609 WP_003406908.1.53628 WP_003406908.1.53643 WP_003406908.1.53667 WP_003406908.1.53679 WP_003406908.1.53715 WP_003406908.1.53730 WP_003406908.1.53742 WP_003406908.1.53743 WP_003406908.1.53754 WP_003406908.1.53775 WP_003406908.1.53787 WP_003406908.1.53803 WP_003406908.1.53818 WP_003406908.1.53822 WP_003406908.1.53853 WP_003406908.1.53865 WP_003406908.1.53888 WP_003406908.1.53900 WP_003406908.1.53912 WP_003406908.1.53914 WP_003406908.1.53952 WP_003406908.1.5398 WP_003406908.1.5408 WP_003406908.1.54089 WP_003406908.1.54093 WP_003406908.1.54099 WP_003406908.1.54112 WP_003406908.1.54125 WP_003406908.1.54141 WP_003406908.1.54162 WP_003406908.1.54179 WP_003406908.1.54206 WP_003406908.1.54218 WP_003406908.1.54227 WP_003406908.1.54232 WP_003406908.1.54241 WP_003406908.1.54245 WP_003406908.1.54247 WP_003406908.1.54260 WP_003406908.1.54275 WP_003406908.1.54280 WP_003406908.1.5429 WP_003406908.1.54294 WP_003406908.1.54314 WP_003406908.1.54347 WP_003406908.1.54351 WP_003406908.1.54370 WP_003406908.1.54428 WP_003406908.1.54449 WP_003406908.1.54494 WP_003406908.1.54502 WP_003406908.1.54514 WP_003406908.1.54519 WP_003406908.1.5452 WP_003406908.1.54531 WP_003406908.1.54537 WP_003406908.1.54553 WP_003406908.1.54555 WP_003406908.1.54575 WP_003406908.1.54633 WP_003406908.1.54686 WP_003406908.1.54687 WP_003406908.1.54705 WP_003406908.1.54730 WP_003406908.1.54732 WP_003406908.1.5475 WP_003406908.1.54797 WP_003406908.1.54807 WP_003406908.1.54836 WP_003406908.1.54838 WP_003406908.1.54860 WP_003406908.1.54888 WP_003406908.1.54897 WP_003406908.1.54905 WP_003406908.1.54909 WP_003406908.1.54937 WP_003406908.1.54939 WP_003406908.1.54944 WP_003406908.1.54945 WP_003406908.1.54953 WP_003406908.1.54964 WP_003406908.1.55015 WP_003406908.1.55022 WP_003406908.1.55023 WP_003406908.1.55051 WP_003406908.1.55072 WP_003406908.1.55088 WP_003406908.1.55106 WP_003406908.1.55126 WP_003406908.1.55128 WP_003406908.1.55140 WP_003406908.1.55150 WP_003406908.1.55210 WP_003406908.1.55227 WP_003406908.1.55248 WP_003406908.1.55257 WP_003406908.1.55258 WP_003406908.1.55267 WP_003406908.1.55279 WP_003406908.1.55307 WP_003406908.1.55326 WP_003406908.1.55328 WP_003406908.1.5533 WP_003406908.1.55345 WP_003406908.1.55396 WP_003406908.1.55398 WP_003406908.1.55441 WP_003406908.1.55501 WP_003406908.1.55504 WP_003406908.1.55578 WP_003406908.1.55626 WP_003406908.1.55641 WP_003406908.1.5569 WP_003406908.1.55723 WP_003406908.1.55735 WP_003406908.1.5574 WP_003406908.1.55772 WP_003406908.1.55802 WP_003406908.1.55807 WP_003406908.1.55819 WP_003406908.1.55821 WP_003406908.1.5583 WP_003406908.1.55849 WP_003406908.1.55856 WP_003406908.1.55860 WP_003406908.1.55882 WP_003406908.1.55883 WP_003406908.1.55894 WP_003406908.1.55902 WP_003406908.1.55908 WP_003406908.1.55909 WP_003406908.1.5591 WP_003406908.1.55961 WP_003406908.1.55977 WP_003406908.1.56028 WP_003406908.1.56057 WP_003406908.1.56060 WP_003406908.1.56107 WP_003406908.1.56132 WP_003406908.1.56163 WP_003406908.1.56167 WP_003406908.1.56178 WP_003406908.1.56287 WP_003406908.1.56292 WP_003406908.1.56327 WP_003406908.1.56341 WP_003406908.1.56365 WP_003406908.1.56394 WP_003406908.1.56443 WP_003406908.1.56473 WP_003406908.1.56478 WP_003406908.1.56500 WP_003406908.1.56517 WP_003406908.1.5656 WP_003406908.1.56577 WP_003406908.1.56593 WP_003406908.1.56625 WP_003406908.1.56637 WP_003406908.1.56670 WP_003406908.1.56697 WP_003406908.1.567 WP_003406908.1.56701 WP_003406908.1.56709 WP_003406908.1.56729 WP_003406908.1.56743 WP_003406908.1.56755 WP_003406908.1.56764 WP_003406908.1.56769 WP_003406908.1.56770 WP_003406908.1.56795 WP_003406908.1.5681 WP_003406908.1.56839 WP_003406908.1.56863 WP_003406908.1.56868 WP_003406908.1.56869 WP_003406908.1.56915 WP_003406908.1.56926 WP_003406908.1.56961 WP_003406908.1.56971 WP_003406908.1.56972 WP_003406908.1.57023 WP_003406908.1.57035 WP_003406908.1.57077 WP_003406908.1.57087 WP_003406908.1.57094 WP_003406908.1.57134 WP_003406908.1.57151 WP_003406908.1.57169 WP_003406908.1.57208 WP_003406908.1.57212 WP_003406908.1.57230 WP_003406908.1.5724 WP_003406908.1.5725 WP_003406908.1.5727 WP_003406908.1.57273 WP_003406908.1.573 WP_003406908.1.57314 WP_003406908.1.57326 WP_003406908.1.57328 WP_003406908.1.57331 WP_003406908.1.57340 WP_003406908.1.57351 WP_003406908.1.57352 WP_003406908.1.57380 WP_003406908.1.57430 WP_003406908.1.5744 WP_003406908.1.57440 WP_003406908.1.5745 WP_003406908.1.57461 WP_003406908.1.57469 WP_003406908.1.57489 WP_003406908.1.575 WP_003406908.1.57509 WP_003406908.1.57519 WP_003406908.1.57551 WP_003406908.1.5758 WP_003406908.1.57596 WP_003406908.1.57604 WP_003406908.1.57616 WP_003406908.1.57617 WP_003406908.1.57619 WP_003406908.1.57627 WP_003406908.1.57642 WP_003406908.1.57658 WP_003406908.1.57667 WP_003406908.1.57675 WP_003406908.1.57708 WP_003406908.1.57794 WP_003406908.1.57821 WP_003406908.1.57825 WP_003406908.1.57843 WP_003406908.1.57906 WP_003406908.1.57924 WP_003406908.1.57926 WP_003406908.1.57930 WP_003406908.1.57957 WP_003406908.1.57960 WP_003406908.1.57964 WP_003406908.1.57991 WP_003406908.1.58000 WP_003406908.1.58086 WP_003406908.1.58101 WP_003406908.1.58103 WP_003406908.1.58108 WP_003406908.1.5811 WP_003406908.1.58121 WP_003406908.1.58145 WP_003406908.1.58164 WP_003406908.1.58174 WP_003406908.1.582 WP_003406908.1.58202 WP_003406908.1.58209 WP_003406908.1.58215 WP_003406908.1.5824 WP_003406908.1.58250 WP_003406908.1.58259 WP_003406908.1.58283 WP_003406908.1.58288 WP_003406908.1.5830 WP_003406908.1.58303 WP_003406908.1.58311 WP_003406908.1.58330 WP_003406908.1.58359 WP_003406908.1.58386 WP_003406908.1.58393 WP_003406908.1.58431 WP_003406908.1.5844 WP_003406908.1.58457 WP_003406908.1.58488 WP_003406908.1.58518 WP_003406908.1.58534 WP_003406908.1.58559 WP_003406908.1.58567 WP_003406908.1.58573 WP_003406908.1.58602 WP_003406908.1.58612 WP_003406908.1.58619 WP_003406908.1.58630 WP_003406908.1.5865 WP_003406908.1.58671 WP_003406908.1.58690 WP_003406908.1.58702 WP_003406908.1.58743 WP_003406908.1.58754 WP_003406908.1.5879 WP_003406908.1.5881 WP_003406908.1.58824 WP_003406908.1.58848 WP_003406908.1.58857 WP_003406908.1.58891 WP_003406908.1.58892 WP_003406908.1.5890 WP_003406908.1.58904 WP_003406908.1.58921 WP_003406908.1.58930 WP_003406908.1.58939 WP_003406908.1.58941 WP_003406908.1.58953 WP_003406908.1.58961 WP_003406908.1.5898 WP_003406908.1.59025 WP_003406908.1.59029 WP_003406908.1.59037 WP_003406908.1.59044 WP_003406908.1.59085 WP_003406908.1.59088 WP_003406908.1.59112 WP_003406908.1.59130 WP_003406908.1.5914 WP_003406908.1.59147 WP_003406908.1.59166 WP_003406908.1.59205 WP_003406908.1.59209 WP_003406908.1.59237 WP_003406908.1.59240 WP_003406908.1.59253 WP_003406908.1.59254 WP_003406908.1.59262 WP_003406908.1.59270 WP_003406908.1.5928 WP_003406908.1.59304 WP_003406908.1.59305 WP_003406908.1.59309 WP_003406908.1.59316 WP_003406908.1.59326 WP_003406908.1.59333 WP_003406908.1.59338 WP_003406908.1.59388 WP_003406908.1.59428 WP_003406908.1.59487 WP_003406908.1.59537 WP_003406908.1.59561 WP_003406908.1.59677 WP_003406908.1.59722 WP_003406908.1.59727 WP_003406908.1.59732 WP_003406908.1.59738 WP_003406908.1.59750 WP_003406908.1.59757 WP_003406908.1.59761 WP_003406908.1.59808 WP_003406908.1.59850 WP_003406908.1.59856 WP_003406908.1.59860 WP_003406908.1.59861 WP_003406908.1.5987 WP_003406908.1.59878 WP_003406908.1.59888 WP_003406908.1.59952 WP_003406908.1.5996 WP_003406908.1.59961 WP_003406908.1.59974 WP_003406908.1.6000 WP_003406908.1.60007 WP_003406908.1.60016 WP_003406908.1.6003 WP_003406908.1.60047 WP_003406908.1.6007 WP_003406908.1.60121 WP_003406908.1.60125 WP_003406908.1.60139 WP_003406908.1.60152 WP_003406908.1.60171 WP_003406908.1.60197 WP_003406908.1.6020 WP_003406908.1.60205 WP_003406908.1.60207 WP_003406908.1.60215 WP_003406908.1.60217 WP_003406908.1.60267 WP_003406908.1.60288 WP_003406908.1.60291 WP_003406908.1.60301 WP_003406908.1.60305 WP_003406908.1.60312 WP_003406908.1.60313 WP_003406908.1.60314 WP_003406908.1.60367 WP_003406908.1.60376 WP_003406908.1.60403 WP_003406908.1.60413 WP_003406908.1.60421 WP_003406908.1.60451 WP_003406908.1.60460 WP_003406908.1.60479 WP_003406908.1.60487 WP_003406908.1.60512 WP_003406908.1.60573 WP_003406908.1.60632 WP_003406908.1.60657 WP_003406908.1.60687 WP_003406908.1.60689 WP_003406908.1.60727 WP_003406908.1.60738 WP_003406908.1.60763 WP_003406908.1.6077 WP_003406908.1.60791 WP_003406908.1.60834 WP_003406908.1.60878 WP_003406908.1.60879 WP_003406908.1.60913 WP_003406908.1.60978 WP_003406908.1.61000 WP_003406908.1.61001 WP_003406908.1.61012 WP_003406908.1.61014 WP_003406908.1.61015 WP_003406908.1.61037 WP_003406908.1.61052 WP_003406908.1.61065 WP_003406908.1.61100 WP_003406908.1.61101 WP_003406908.1.61138 WP_003406908.1.61142 WP_003406908.1.61198 WP_003406908.1.61234 WP_003406908.1.61256 WP_003406908.1.61281 WP_003406908.1.61314 WP_003406908.1.61321 WP_003406908.1.61326 WP_003406908.1.61328 WP_003406908.1.61391 WP_003406908.1.61406 WP_003406908.1.61409 WP_003406908.1.61420 WP_003406908.1.61422 WP_003406908.1.61425 WP_003406908.1.61428 WP_003406908.1.61469 WP_003406908.1.61494 WP_003406908.1.61522 WP_003406908.1.61552 WP_003406908.1.61557 WP_003406908.1.61567 WP_003406908.1.61571 WP_003406908.1.61573 WP_003406908.1.61584 WP_003406908.1.61586 WP_003406908.1.6160 WP_003406908.1.6163 WP_003406908.1.61655 WP_003406908.1.61665 WP_003406908.1.61669 WP_003406908.1.61682 WP_003406908.1.61692 WP_003406908.1.61719 WP_003406908.1.61728 WP_003406908.1.61750 WP_003406908.1.61754 WP_003406908.1.61755 WP_003406908.1.61757 WP_003406908.1.61778 WP_003406908.1.6179 WP_003406908.1.61793 WP_003406908.1.61816 WP_003406908.1.61842 WP_003406908.1.61850 WP_003406908.1.61862 WP_003406908.1.61865 WP_003406908.1.61868 WP_003406908.1.61911 WP_003406908.1.61925 WP_003406908.1.61941 WP_003406908.1.61953 WP_003406908.1.61986 WP_003406908.1.61987 WP_003406908.1.61998 WP_003406908.1.62021 WP_003406908.1.62087 WP_003406908.1.62089 WP_003406908.1.62101 WP_003406908.1.62104 WP_003406908.1.6211 WP_003406908.1.62132 WP_003406908.1.62162 WP_003406908.1.62225 WP_003406908.1.62230 WP_003406908.1.62238 WP_003406908.1.62249 WP_003406908.1.62270 WP_003406908.1.62281 WP_003406908.1.62307 WP_003406908.1.6231 WP_003406908.1.62359 WP_003406908.1.62360 WP_003406908.1.62371 WP_003406908.1.62379 WP_003406908.1.62395 WP_003406908.1.62408 WP_003406908.1.62449 WP_003406908.1.62468 WP_003406908.1.6248 WP_003406908.1.62508 WP_003406908.1.62565 WP_003406908.1.62594 WP_003406908.1.62606 WP_003406908.1.62616 WP_003406908.1.62666 WP_003406908.1.62687 WP_003406908.1.62715 WP_003406908.1.62730 WP_003406908.1.62738 WP_003406908.1.62761 WP_003406908.1.62766 WP_003406908.1.62786 WP_003406908.1.62813 WP_003406908.1.62839 WP_003406908.1.62841 WP_003406908.1.62909 WP_003406908.1.62936 WP_003406908.1.6294 WP_003406908.1.6295 WP_003406908.1.62962 WP_003406908.1.63007 WP_003406908.1.63019 WP_003406908.1.63032 WP_003406908.1.63037 WP_003406908.1.63064 WP_003406908.1.63066 WP_003406908.1.63072 WP_003406908.1.6308 WP_003406908.1.63081 WP_003406908.1.63096 WP_003406908.1.63106 WP_003406908.1.63144 WP_003406908.1.63154 WP_003406908.1.63160 WP_003406908.1.63161 WP_003406908.1.63166 WP_003406908.1.63175 WP_003406908.1.63194 WP_003406908.1.6322 WP_003406908.1.63222 WP_003406908.1.63247 WP_003406908.1.6328 WP_003406908.1.63291 WP_003406908.1.63312 WP_003406908.1.63317 WP_003406908.1.63331 WP_003406908.1.63373 WP_003406908.1.63384 WP_003406908.1.63403 WP_003406908.1.63424 WP_003406908.1.63428 WP_003406908.1.6345 WP_003406908.1.63464 WP_003406908.1.63483 WP_003406908.1.63502 WP_003406908.1.63504 WP_003406908.1.63522 WP_003406908.1.63530 WP_003406908.1.63538 WP_003406908.1.63564 WP_003406908.1.63567 WP_003406908.1.63596 WP_003406908.1.63600 WP_003406908.1.63623 WP_003406908.1.63624 WP_003406908.1.63625 WP_003406908.1.63627 WP_003406908.1.63654 WP_003406908.1.63662 WP_003406908.1.63711 WP_003406908.1.63734 WP_003406908.1.63807 WP_003406908.1.63819 WP_003406908.1.63844 WP_003406908.1.63888 WP_003406908.1.63913 WP_003406908.1.63915 WP_003406908.1.63918 WP_003406908.1.63961 WP_003406908.1.63970 WP_003406908.1.64027 WP_003406908.1.64058 WP_003406908.1.64065 WP_003406908.1.6407 WP_003406908.1.64082 WP_003406908.1.64091 WP_003406908.1.64102 WP_003406908.1.64104 WP_003406908.1.64119 WP_003406908.1.64169 WP_003406908.1.64219 WP_003406908.1.6422 WP_003406908.1.64222 WP_003406908.1.64223 WP_003406908.1.64228 WP_003406908.1.64235 WP_003406908.1.64249 WP_003406908.1.6427 WP_003406908.1.64278 WP_003406908.1.64287 WP_003406908.1.64414 WP_003406908.1.64419 WP_003406908.1.6443 WP_003406908.1.64463 WP_003406908.1.64480 WP_003406908.1.64497 WP_003406908.1.64506 WP_003406908.1.64511 WP_003406908.1.64513 WP_003406908.1.64514 WP_003406908.1.64515 WP_003406908.1.64522 WP_003406908.1.64526 WP_003406908.1.64543 WP_003406908.1.6456 WP_003406908.1.64567 WP_003406908.1.64588 WP_003406908.1.64589 WP_003406908.1.64594 WP_003406908.1.64595 WP_003406908.1.64608 WP_003406908.1.64619 WP_003406908.1.64629 WP_003406908.1.6464 WP_003406908.1.64664 WP_003406908.1.64669 WP_003406908.1.64672 WP_003406908.1.64682 WP_003406908.1.64727 WP_003406908.1.64729 WP_003406908.1.64774 WP_003406908.1.64776 WP_003406908.1.64802 WP_003406908.1.64832 WP_003406908.1.6486 WP_003406908.1.64870 WP_003406908.1.64898 WP_003406908.1.64922 WP_003406908.1.64924 WP_003406908.1.6493 WP_003406908.1.64937 WP_003406908.1.64941 WP_003406908.1.64966 WP_003406908.1.64973 WP_003406908.1.65001 WP_003406908.1.65026 WP_003406908.1.65053 WP_003406908.1.65070 WP_003406908.1.65079 WP_003406908.1.65102 WP_003406908.1.65157 WP_003406908.1.65181 WP_003406908.1.65212 WP_003406908.1.65229 WP_003406908.1.6523 WP_003406908.1.65253 WP_003406908.1.65289 WP_003406908.1.65291 WP_003406908.1.65315 WP_003406908.1.65329 WP_003406908.1.65359 WP_003406908.1.6536 WP_003406908.1.65374 WP_003406908.1.65414 WP_003406908.1.65416 WP_003406908.1.65433 WP_003406908.1.65455 WP_003406908.1.65467 WP_003406908.1.65488 WP_003406908.1.65529 WP_003406908.1.65539 WP_003406908.1.65583 WP_003406908.1.65612 WP_003406908.1.65635 WP_003406908.1.65637 WP_003406908.1.65648 WP_003406908.1.65683 WP_003406908.1.65686 WP_003406908.1.65688 WP_003406908.1.65707 WP_003406908.1.65733 WP_003406908.1.65746 WP_003406908.1.65747 WP_003406908.1.65759 WP_003406908.1.65816 WP_003406908.1.65830 WP_003406908.1.65858 WP_003406908.1.65862 WP_003406908.1.65869 WP_003406908.1.65893 WP_003406908.1.65929 WP_003406908.1.65932 WP_003406908.1.65958 WP_003406908.1.65974 WP_003406908.1.66004 WP_003406908.1.66013 WP_003406908.1.6606 WP_003406908.1.66089 WP_003406908.1.66149 WP_003406908.1.66151 WP_003406908.1.66229 WP_003406908.1.66276 WP_003406908.1.66293 WP_003406908.1.66297 WP_003406908.1.66323 WP_003406908.1.66325 WP_003406908.1.6633 WP_003406908.1.66334 WP_003406908.1.66355 WP_003406908.1.66367 WP_003406908.1.66394 WP_003406908.1.66396 WP_003406908.1.66451 WP_003406908.1.66455 WP_003406908.1.66457 WP_003406908.1.66460 WP_003406908.1.66464 WP_003406908.1.66466 WP_003406908.1.66487 WP_003406908.1.66504 WP_003406908.1.66544 WP_003406908.1.66558 WP_003406908.1.66580 WP_003406908.1.66582 WP_003406908.1.66612 WP_003406908.1.66615 WP_003406908.1.66617 WP_003406908.1.66635 WP_003406908.1.66656 WP_003406908.1.66663 WP_003406908.1.66675 WP_003406908.1.66715 WP_003406908.1.66718 WP_003406908.1.66762 WP_003406908.1.66776 WP_003406908.1.66808 WP_003406908.1.66817 WP_003406908.1.66819 WP_003406908.1.66826 WP_003406908.1.66830 WP_003406908.1.66842 WP_003406908.1.66868 WP_003406908.1.66878 WP_003406908.1.66880 WP_003406908.1.66893 WP_003406908.1.66961 WP_003406908.1.67005 WP_003406908.1.6704 WP_003406908.1.67044 WP_003406908.1.67061 WP_003406908.1.67089 WP_003406908.1.67098 WP_003406908.1.67146 WP_003406908.1.67170 WP_003406908.1.67197 WP_003406908.1.67198 WP_003406908.1.6720 WP_003406908.1.67207 WP_003406908.1.67218 WP_003406908.1.67225 WP_003406908.1.67231 WP_003406908.1.6724 WP_003406908.1.67257 WP_003406908.1.67298 WP_003406908.1.67307 WP_003406908.1.67324 WP_003406908.1.67332 WP_003406908.1.67346 WP_003406908.1.67354 WP_003406908.1.67360 WP_003406908.1.67381 WP_003406908.1.67396 WP_003406908.1.67417 WP_003406908.1.67422 WP_003406908.1.67453 WP_003406908.1.67459 WP_003406908.1.6746 WP_003406908.1.67473 WP_003406908.1.67481 WP_003406908.1.67482 WP_003406908.1.67496 WP_003406908.1.67499 WP_003406908.1.67516 WP_003406908.1.67523 WP_003406908.1.67536 WP_003406908.1.67575 WP_003406908.1.67587 WP_003406908.1.67598 WP_003406908.1.67600 WP_003406908.1.67602 WP_003406908.1.67630 WP_003406908.1.67679 WP_003406908.1.67692 WP_003406908.1.67744 WP_003406908.1.6775 WP_003406908.1.67750 WP_003406908.1.6777 WP_003406908.1.67809 WP_003406908.1.67816 WP_003406908.1.67844 WP_003406908.1.67848 WP_003406908.1.67870 WP_003406908.1.67888 WP_003406908.1.67915 WP_003406908.1.67945 WP_003406908.1.67949 WP_003406908.1.67980 WP_003406908.1.67982 WP_003406908.1.68022 WP_003406908.1.68029 WP_003406908.1.68037 WP_003406908.1.68038 WP_003406908.1.68045 WP_003406908.1.68057 WP_003406908.1.68083 WP_003406908.1.68088 WP_003406908.1.68106 WP_003406908.1.68110 WP_003406908.1.68153 WP_003406908.1.68164 WP_003406908.1.68169 WP_003406908.1.68193 WP_003406908.1.68212 WP_003406908.1.68227 WP_003406908.1.68243 WP_003406908.1.6825 WP_003406908.1.68297 WP_003406908.1.68309 WP_003406908.1.68325 WP_003406908.1.68329 WP_003406908.1.68340 WP_003406908.1.68384 WP_003406908.1.68388 WP_003406908.1.68429 WP_003406908.1.6843 WP_003406908.1.68433 WP_003406908.1.68444 WP_003406908.1.68518 WP_003406908.1.68569 WP_003406908.1.68576 WP_003406908.1.68580 WP_003406908.1.68586 WP_003406908.1.68623 WP_003406908.1.68624 WP_003406908.1.68637 WP_003406908.1.68646 WP_003406908.1.68667 WP_003406908.1.68669 WP_003406908.1.68672 WP_003406908.1.68684 WP_003406908.1.68704 WP_003406908.1.68708 WP_003406908.1.6872 WP_003406908.1.68730 WP_003406908.1.68734 WP_003406908.1.68748 WP_003406908.1.68754 WP_003406908.1.6876 WP_003406908.1.68761 WP_003406908.1.68763 WP_003406908.1.68766 WP_003406908.1.68774 WP_003406908.1.68796 WP_003406908.1.68824 WP_003406908.1.68833 WP_003406908.1.68841 WP_003406908.1.68859 WP_003406908.1.68876 WP_003406908.1.68906 WP_003406908.1.68916 WP_003406908.1.68923 WP_003406908.1.68945 WP_003406908.1.6896 WP_003406908.1.68981 WP_003406908.1.68984 WP_003406908.1.68997 WP_003406908.1.69008 WP_003406908.1.69076 WP_003406908.1.69079 WP_003406908.1.6908 WP_003406908.1.69082 WP_003406908.1.69178 WP_003406908.1.69181 WP_003406908.1.69208 WP_003406908.1.69231 WP_003406908.1.69256 WP_003406908.1.69311 WP_003406908.1.69315 WP_003406908.1.69322 WP_003406908.1.69342 WP_003406908.1.6935 WP_003406908.1.6936 WP_003406908.1.69369 WP_003406908.1.69374 WP_003406908.1.69398 WP_003406908.1.69401 WP_003406908.1.69426 WP_003406908.1.69427 WP_003406908.1.69429 WP_003406908.1.6949 WP_003406908.1.6951 WP_003406908.1.69511 WP_003406908.1.69526 WP_003406908.1.69528 WP_003406908.1.69547 WP_003406908.1.69573 WP_003406908.1.69581 WP_003406908.1.6960 WP_003406908.1.69634 WP_003406908.1.69647 WP_003406908.1.69659 WP_003406908.1.69673 WP_003406908.1.69682 WP_003406908.1.69684 WP_003406908.1.69686 WP_003406908.1.69707 WP_003406908.1.69709 WP_003406908.1.69723 WP_003406908.1.69736 WP_003406908.1.69778 WP_003406908.1.69800 WP_003406908.1.69802 WP_003406908.1.69845 WP_003406908.1.69870 WP_003406908.1.69873 WP_003406908.1.69898 WP_003406908.1.69913 WP_003406908.1.69925 WP_003406908.1.69931 WP_003406908.1.69938 WP_003406908.1.69955 WP_003406908.1.69981 WP_003406908.1.69990 WP_003406908.1.70 WP_003406908.1.70000 WP_003406908.1.70017 WP_003406908.1.70032 WP_003406908.1.70055 WP_003406908.1.70062 WP_003406908.1.70072 WP_003406908.1.70131 WP_003406908.1.70132 WP_003406908.1.7022 WP_003406908.1.70227 WP_003406908.1.70255 WP_003406908.1.70271 WP_003406908.1.70274 WP_003406908.1.70325 WP_003406908.1.70328 WP_003406908.1.70356 WP_003406908.1.70364 WP_003406908.1.70368 WP_003406908.1.70369 WP_003406908.1.70418 WP_003406908.1.70422 WP_003406908.1.70435 WP_003406908.1.70444 WP_003406908.1.70471 WP_003406908.1.70480 WP_003406908.1.70494 WP_003406908.1.70498 WP_003406908.1.70505 WP_003406908.1.70525 WP_003406908.1.70573 WP_003406908.1.70577 WP_003406908.1.70610 WP_003406908.1.70615 WP_003406908.1.70618 WP_003406908.1.70622 WP_003406908.1.70626 WP_003406908.1.70668 WP_003406908.1.70699 WP_003406908.1.70704 WP_003406908.1.70729 WP_003406908.1.70757 WP_003406908.1.70782 WP_003406908.1.70796 WP_003406908.1.70830 WP_003406908.1.70834 WP_003406908.1.7084 WP_003406908.1.70840 WP_003406908.1.70864 WP_003406908.1.70871 WP_003406908.1.70915 WP_003406908.1.70955 WP_003406908.1.70958 WP_003406908.1.70964 WP_003406908.1.70976 WP_003406908.1.71015 WP_003406908.1.71026 WP_003406908.1.71063 WP_003406908.1.71076 WP_003406908.1.71083 WP_003406908.1.7111 WP_003406908.1.71118 WP_003406908.1.71128 WP_003406908.1.7113 WP_003406908.1.71187 WP_003406908.1.71191 WP_003406908.1.71255 WP_003406908.1.71258 WP_003406908.1.71259 WP_003406908.1.71289 WP_003406908.1.71326 WP_003406908.1.71329 WP_003406908.1.71331 WP_003406908.1.71344 WP_003406908.1.71390 WP_003406908.1.71414 WP_003406908.1.71457 WP_003406908.1.7146 WP_003406908.1.71464 WP_003406908.1.71490 WP_003406908.1.71492 WP_003406908.1.71509 WP_003406908.1.71516 WP_003406908.1.71517 WP_003406908.1.71527 WP_003406908.1.71532 WP_003406908.1.71545 WP_003406908.1.71546 WP_003406908.1.71604 WP_003406908.1.71621 WP_003406908.1.71630 WP_003406908.1.71638 WP_003406908.1.71654 WP_003406908.1.71664 WP_003406908.1.71665 WP_003406908.1.71683 WP_003406908.1.71701 WP_003406908.1.71718 WP_003406908.1.71731 WP_003406908.1.71778 WP_003406908.1.71781 WP_003406908.1.71803 WP_003406908.1.71820 WP_003406908.1.71847 WP_003406908.1.7185 WP_003406908.1.71851 WP_003406908.1.71909 WP_003406908.1.71957 WP_003406908.1.71970 WP_003406908.1.72047 WP_003406908.1.72061 WP_003406908.1.72062 WP_003406908.1.72072 WP_003406908.1.72111 WP_003406908.1.72122 WP_003406908.1.72128 WP_003406908.1.72143 WP_003406908.1.7216 WP_003406908.1.72168 WP_003406908.1.72179 WP_003406908.1.72209 WP_003406908.1.72218 WP_003406908.1.72219 WP_003406908.1.72227 WP_003406908.1.7224 WP_003406908.1.72268 WP_003406908.1.72380 WP_003406908.1.72401 WP_003406908.1.72405 WP_003406908.1.72420 WP_003406908.1.72441 WP_003406908.1.72451 WP_003406908.1.72452 WP_003406908.1.72457 WP_003406908.1.72459 WP_003406908.1.72460 WP_003406908.1.72466 WP_003406908.1.72487 WP_003406908.1.72488 WP_003406908.1.72492 WP_003406908.1.72506 WP_003406908.1.72543 WP_003406908.1.7256 WP_003406908.1.72576 WP_003406908.1.72578 WP_003406908.1.72585 WP_003406908.1.72591 WP_003406908.1.72592 WP_003406908.1.72640 WP_003406908.1.7266 WP_003406908.1.72661 WP_003406908.1.72739 WP_003406908.1.72744 WP_003406908.1.72755 WP_003406908.1.72759 WP_003406908.1.72784 WP_003406908.1.72792 WP_003406908.1.72826 WP_003406908.1.72831 WP_003406908.1.72852 WP_003406908.1.72853 WP_003406908.1.72879 WP_003406908.1.72880 WP_003406908.1.72938 WP_003406908.1.72954 WP_003406908.1.72957 WP_003406908.1.72959 WP_003406908.1.72973 WP_003406908.1.72982 WP_003406908.1.72988 WP_003406908.1.72993 WP_003406908.1.73006 WP_003406908.1.73013 WP_003406908.1.73025 WP_003406908.1.73028 WP_003406908.1.73042 WP_003406908.1.73045 WP_003406908.1.73092 WP_003406908.1.73118 WP_003406908.1.7312 WP_003406908.1.73127 WP_003406908.1.73134 WP_003406908.1.73150 WP_003406908.1.73154 WP_003406908.1.73163 WP_003406908.1.73182 WP_003406908.1.73205 WP_003406908.1.7321 WP_003406908.1.73310 WP_003406908.1.73365 WP_003406908.1.73391 WP_003406908.1.73404 WP_003406908.1.73424 WP_003406908.1.73436 WP_003406908.1.73445 WP_003406908.1.73465 WP_003406908.1.73466 WP_003406908.1.73470 WP_003406908.1.73471 WP_003406908.1.73478 WP_003406908.1.73482 WP_003406908.1.73507 WP_003406908.1.73532 WP_003406908.1.73550 WP_003406908.1.73564 WP_003406908.1.73623 WP_003406908.1.73629 WP_003406908.1.73644 WP_003406908.1.7366 WP_003406908.1.73661 WP_003406908.1.7368 WP_003406908.1.73723 WP_003406908.1.73744 WP_003406908.1.73750 WP_003406908.1.73760 WP_003406908.1.73774 WP_003406908.1.7379 WP_003406908.1.73813 WP_003406908.1.73840 WP_003406908.1.73876 WP_003406908.1.7389 WP_003406908.1.73986 WP_003406908.1.74016 WP_003406908.1.74039 WP_003406908.1.74083 WP_003406908.1.74101 WP_003406908.1.74107 WP_003406908.1.74120 WP_003406908.1.74129 WP_003406908.1.74144 WP_003406908.1.74190 WP_003406908.1.74210 WP_003406908.1.7423 WP_003406908.1.74259 WP_003406908.1.74262 WP_003406908.1.74269 WP_003406908.1.74282 WP_003406908.1.74291 WP_003406908.1.74296 WP_003406908.1.74304 WP_003406908.1.7432 WP_003406908.1.74347 WP_003406908.1.7436 WP_003406908.1.74378 WP_003406908.1.74382 WP_003406908.1.74395 WP_003406908.1.74400 WP_003406908.1.74401 WP_003406908.1.74442 WP_003406908.1.74477 WP_003406908.1.74487 WP_003406908.1.74499 WP_003406908.1.74504 WP_003406908.1.74511 WP_003406908.1.74523 WP_003406908.1.74525 WP_003406908.1.74551 WP_003406908.1.74555 WP_003406908.1.74628 WP_003406908.1.74641 WP_003406908.1.74653 WP_003406908.1.74660 WP_003406908.1.74683 WP_003406908.1.7469 WP_003406908.1.74725 WP_003406908.1.74760 WP_003406908.1.74809 WP_003406908.1.74820 WP_003406908.1.74870 WP_003406908.1.74881 WP_003406908.1.74888 WP_003406908.1.74952 WP_003406908.1.7496 WP_003406908.1.74988 WP_003406908.1.75043 WP_003406908.1.75045 WP_003406908.1.75055 WP_003406908.1.75078 WP_003406908.1.75081 WP_003406908.1.75120 WP_003406908.1.75163 WP_003406908.1.75188 WP_003406908.1.75200 WP_003406908.1.75202 WP_003406908.1.75234 WP_003406908.1.75239 WP_003406908.1.75250 WP_003406908.1.75263 WP_003406908.1.75281 WP_003406908.1.75342 WP_003406908.1.7535 WP_003406908.1.75376 WP_003406908.1.75391 WP_003406908.1.75395 WP_003406908.1.75441 WP_003406908.1.75510 WP_003406908.1.75581 WP_003406908.1.75598 WP_003406908.1.75635 WP_003406908.1.75645 WP_003406908.1.75665 WP_003406908.1.75671 WP_003406908.1.75749 WP_003406908.1.75772 WP_003406908.1.75774 WP_003406908.1.75811 WP_003406908.1.75833 WP_003406908.1.7585 WP_003406908.1.75864 WP_003406908.1.75868 WP_003406908.1.75878 WP_003406908.1.75927 WP_003406908.1.75946 WP_003406908.1.75968 WP_003406908.1.75974 WP_003406908.1.76007 WP_003406908.1.76016 WP_003406908.1.76032 WP_003406908.1.76037 WP_003406908.1.7604 WP_003406908.1.76045 WP_003406908.1.76052 WP_003406908.1.76058 WP_003406908.1.76064 WP_003406908.1.76110 WP_003406908.1.76126 WP_003406908.1.76133 WP_003406908.1.76138 WP_003406908.1.76157 WP_003406908.1.76172 WP_003406908.1.76177 WP_003406908.1.76183 WP_003406908.1.76209 WP_003406908.1.76272 WP_003406908.1.76277 WP_003406908.1.76280 WP_003406908.1.76281 WP_003406908.1.76291 WP_003406908.1.76297 WP_003406908.1.76360 WP_003406908.1.76379 WP_003406908.1.76403 WP_003406908.1.76413 WP_003406908.1.76414 WP_003406908.1.76427 WP_003406908.1.76436 WP_003406908.1.76442 WP_003406908.1.76443 WP_003406908.1.76456 WP_003406908.1.76521 WP_003406908.1.76533 WP_003406908.1.76616 WP_003406908.1.76625 WP_003406908.1.76629 WP_003406908.1.76635 WP_003406908.1.76638 WP_003406908.1.76639 WP_003406908.1.76640 WP_003406908.1.76644 WP_003406908.1.76677 WP_003406908.1.76678 WP_003406908.1.76734 WP_003406908.1.76744 WP_003406908.1.76750 WP_003406908.1.76754 WP_003406908.1.76757 WP_003406908.1.76818 WP_003406908.1.76824 WP_003406908.1.76835 WP_003406908.1.76873 WP_003406908.1.76881 WP_003406908.1.76888 WP_003406908.1.76900 WP_003406908.1.7691 WP_003406908.1.76947 WP_003406908.1.76954 WP_003406908.1.76955 WP_003406908.1.76963 WP_003406908.1.76976 WP_003406908.1.770 WP_003406908.1.77000 WP_003406908.1.77008 WP_003406908.1.77021 WP_003406908.1.77056 WP_003406908.1.77065 WP_003406908.1.77075 WP_003406908.1.77093 WP_003406908.1.77107 WP_003406908.1.77115 WP_003406908.1.77118 WP_003406908.1.77125 WP_003406908.1.77141 WP_003406908.1.77142 WP_003406908.1.77166 WP_003406908.1.77250 WP_003406908.1.77252 WP_003406908.1.77260 WP_003406908.1.77266 WP_003406908.1.77280 WP_003406908.1.77312 WP_003406908.1.77348 WP_003406908.1.77351 WP_003406908.1.77352 WP_003406908.1.77361 WP_003406908.1.774 WP_003406908.1.7740 WP_003406908.1.77404 WP_003406908.1.77425 WP_003406908.1.77463 WP_003406908.1.77474 WP_003406908.1.7748 WP_003406908.1.77484 WP_003406908.1.77491 WP_003406908.1.77499 WP_003406908.1.77510 WP_003406908.1.77530 WP_003406908.1.77554 WP_003406908.1.77559 WP_003406908.1.77599 WP_003406908.1.77605 WP_003406908.1.7762 WP_003406908.1.77627 WP_003406908.1.77649 WP_003406908.1.77654 WP_003406908.1.7766 WP_003406908.1.77667 WP_003406908.1.77704 WP_003406908.1.77706 WP_003406908.1.77726 WP_003406908.1.77774 WP_003406908.1.7778 WP_003406908.1.77809 WP_003406908.1.77820 WP_003406908.1.77843 WP_003406908.1.77855 WP_003406908.1.77868 WP_003406908.1.77879 WP_003406908.1.77890 WP_003406908.1.77909 WP_003406908.1.77911 WP_003406908.1.77931 WP_003406908.1.77984 WP_003406908.1.78020 WP_003406908.1.78075 WP_003406908.1.78084 WP_003406908.1.78086 WP_003406908.1.78098 WP_003406908.1.78105 WP_003406908.1.78113 WP_003406908.1.78136 WP_003406908.1.78162 WP_003406908.1.7817 WP_003406908.1.78200 WP_003406908.1.78216 WP_003406908.1.78236 WP_003406908.1.78238 WP_003406908.1.78322 WP_003406908.1.78338 WP_003406908.1.7836 WP_003406908.1.78360 WP_003406908.1.78386 WP_003406908.1.78429 WP_003406908.1.78435 WP_003406908.1.7844 WP_003406908.1.78459 WP_003406908.1.78488 WP_003406908.1.7849 WP_003406908.1.78499 WP_003406908.1.785 WP_003406908.1.78516 WP_003406908.1.78524 WP_003406908.1.78526 WP_003406908.1.78538 WP_003406908.1.78544 WP_003406908.1.78545 WP_003406908.1.78547 WP_003406908.1.78574 WP_003406908.1.78580 WP_003406908.1.7860 WP_003406908.1.78620 WP_003406908.1.78646 WP_003406908.1.78648 WP_003406908.1.78649 WP_003406908.1.78655 WP_003406908.1.78657 WP_003406908.1.78659 WP_003406908.1.7869 WP_003406908.1.78692 WP_003406908.1.78760 WP_003406908.1.78766 WP_003406908.1.78776 WP_003406908.1.78778 WP_003406908.1.78784 WP_003406908.1.78788 WP_003406908.1.78790 WP_003406908.1.78848 WP_003406908.1.78860 WP_003406908.1.7887 WP_003406908.1.78884 WP_003406908.1.78932 WP_003406908.1.78969 WP_003406908.1.78977 WP_003406908.1.78980 WP_003406908.1.79005 WP_003406908.1.79016 WP_003406908.1.79033 WP_003406908.1.79064 WP_003406908.1.79066 WP_003406908.1.79068 WP_003406908.1.79077 WP_003406908.1.79095 WP_003406908.1.79112 WP_003406908.1.79122 WP_003406908.1.79145 WP_003406908.1.79152 WP_003406908.1.79163 WP_003406908.1.79182 WP_003406908.1.79198 WP_003406908.1.79213 WP_003406908.1.79218 WP_003406908.1.79268 WP_003406908.1.79273 WP_003406908.1.79278 WP_003406908.1.79290 WP_003406908.1.79319 WP_003406908.1.79325 WP_003406908.1.79326 WP_003406908.1.7933 WP_003406908.1.79330 WP_003406908.1.79339 WP_003406908.1.79394 WP_003406908.1.79399 WP_003406908.1.79413 WP_003406908.1.79445 WP_003406908.1.79447 WP_003406908.1.79455 WP_003406908.1.79471 WP_003406908.1.79480 WP_003406908.1.79482 WP_003406908.1.79488 WP_003406908.1.79500 WP_003406908.1.79502 WP_003406908.1.79508 WP_003406908.1.79514 WP_003406908.1.79561 WP_003406908.1.79565 WP_003406908.1.79578 WP_003406908.1.79588 WP_003406908.1.79598 WP_003406908.1.79615 WP_003406908.1.79684 WP_003406908.1.79698 WP_003406908.1.797 WP_003406908.1.79744 WP_003406908.1.79784 WP_003406908.1.79802 WP_003406908.1.79819 WP_003406908.1.79826 WP_003406908.1.79828 WP_003406908.1.79851 WP_003406908.1.79853 WP_003406908.1.79863 WP_003406908.1.79881 WP_003406908.1.79885 WP_003406908.1.79898 WP_003406908.1.7990 WP_003406908.1.79900 WP_003406908.1.79913 WP_003406908.1.79918 WP_003406908.1.79947 WP_003406908.1.79948 WP_003406908.1.7995 WP_003406908.1.7997 WP_003406908.1.80004 WP_003406908.1.80022 WP_003406908.1.80030 WP_003406908.1.80054 WP_003406908.1.80084 WP_003406908.1.80099 WP_003406908.1.80129 WP_003406908.1.80177 WP_003406908.1.80234 WP_003406908.1.8026 WP_003406908.1.80275 WP_003406908.1.8029 WP_003406908.1.80299 WP_003406908.1.80300 WP_003406908.1.80304 WP_003406908.1.80326 WP_003406908.1.80351 WP_003406908.1.8037 WP_003406908.1.80370 WP_003406908.1.80387 WP_003406908.1.80399 WP_003406908.1.8044 WP_003406908.1.80451 WP_003406908.1.80458 WP_003406908.1.80461 WP_003406908.1.80490 WP_003406908.1.80503 WP_003406908.1.80507 WP_003406908.1.80552 WP_003406908.1.80576 WP_003406908.1.80588 WP_003406908.1.80599 WP_003406908.1.8060 WP_003406908.1.80624 WP_003406908.1.80636 WP_003406908.1.80669 WP_003406908.1.80673 WP_003406908.1.80711 WP_003406908.1.80714 WP_003406908.1.80743 WP_003406908.1.80784 WP_003406908.1.80815 WP_003406908.1.80853 WP_003406908.1.80918 WP_003406908.1.8093 WP_003406908.1.80967 WP_003406908.1.8097 WP_003406908.1.80988 WP_003406908.1.81007 WP_003406908.1.81013 WP_003406908.1.8105 WP_003406908.1.81059 WP_003406908.1.81063 WP_003406908.1.81066 WP_003406908.1.81075 WP_003406908.1.81091 WP_003406908.1.81119 WP_003406908.1.81125 WP_003406908.1.81136 WP_003406908.1.8114 WP_003406908.1.81189 WP_003406908.1.81192 WP_003406908.1.812 WP_003406908.1.81230 WP_003406908.1.81249 WP_003406908.1.81250 WP_003406908.1.81264 WP_003406908.1.8128 WP_003406908.1.81297 WP_003406908.1.8138 WP_003406908.1.81407 WP_003406908.1.8143 WP_003406908.1.81439 WP_003406908.1.81465 WP_003406908.1.81505 WP_003406908.1.81529 WP_003406908.1.81538 WP_003406908.1.81541 WP_003406908.1.81560 WP_003406908.1.81561 WP_003406908.1.81567 WP_003406908.1.81583 WP_003406908.1.81686 WP_003406908.1.81712 WP_003406908.1.81720 WP_003406908.1.81731 WP_003406908.1.81774 WP_003406908.1.81788 WP_003406908.1.81809 WP_003406908.1.81820 WP_003406908.1.81850 WP_003406908.1.81883 WP_003406908.1.81891 WP_003406908.1.81911 WP_003406908.1.81918 WP_003406908.1.82011 WP_003406908.1.82048 WP_003406908.1.82069 WP_003406908.1.82071 WP_003406908.1.82108 WP_003406908.1.82136 WP_003406908.1.82142 WP_003406908.1.8215 WP_003406908.1.82158 WP_003406908.1.8217 WP_003406908.1.82209 WP_003406908.1.82210 WP_003406908.1.82228 WP_003406908.1.82236 WP_003406908.1.82251 WP_003406908.1.82271 WP_003406908.1.82305 WP_003406908.1.82307 WP_003406908.1.82309 WP_003406908.1.82317 WP_003406908.1.8232 WP_003406908.1.82346 WP_003406908.1.82374 WP_003406908.1.82385 WP_003406908.1.82429 WP_003406908.1.82460 WP_003406908.1.82462 WP_003406908.1.82483 WP_003406908.1.82494 WP_003406908.1.82531 WP_003406908.1.82546 WP_003406908.1.82547 WP_003406908.1.82549 WP_003406908.1.82577 WP_003406908.1.82592 WP_003406908.1.82597 WP_003406908.1.82598 WP_003406908.1.82625 WP_003406908.1.82642 WP_003406908.1.82651 WP_003406908.1.82653 WP_003406908.1.82681 WP_003406908.1.82685 WP_003406908.1.8271 WP_003406908.1.82712 WP_003406908.1.8273 WP_003406908.1.82743 WP_003406908.1.82757 WP_003406908.1.82774 WP_003406908.1.82803 WP_003406908.1.82836 WP_003406908.1.82860 WP_003406908.1.82871 WP_003406908.1.82892 WP_003406908.1.82935 WP_003406908.1.82957 WP_003406908.1.82973 WP_003406908.1.82981 WP_003406908.1.82983 WP_003406908.1.83004 WP_003406908.1.83009 WP_003406908.1.83044 WP_003406908.1.83065 WP_003406908.1.83074 WP_003406908.1.83110 WP_003406908.1.83146 WP_003406908.1.83149 WP_003406908.1.83159 WP_003406908.1.8317 WP_003406908.1.83173 WP_003406908.1.83181 WP_003406908.1.83182 WP_003406908.1.83191 WP_003406908.1.83197 WP_003406908.1.83212 WP_003406908.1.8326 WP_003406908.1.83262 WP_003406908.1.83268 WP_003406908.1.83273 WP_003406908.1.83309 WP_003406908.1.83332 WP_003406908.1.83334 WP_003406908.1.83341 WP_003406908.1.83349 WP_003406908.1.8335 WP_003406908.1.83353 WP_003406908.1.83367 WP_003406908.1.83380 WP_003406908.1.83381 WP_003406908.1.83389 WP_003406908.1.83408 WP_003406908.1.83409 WP_003406908.1.83435 WP_003406908.1.83470 WP_003406908.1.83524 WP_003406908.1.83526 WP_003406908.1.8358 WP_003406908.1.83589 WP_003406908.1.83601 WP_003406908.1.83611 WP_003406908.1.83638 WP_003406908.1.83648 WP_003406908.1.83656 WP_003406908.1.83667 WP_003406908.1.83689 WP_003406908.1.83692 WP_003406908.1.83704 WP_003406908.1.83705 WP_003406908.1.83766 WP_003406908.1.83793 WP_003406908.1.83794 WP_003406908.1.83802 WP_003406908.1.83805 WP_003406908.1.83839 WP_003406908.1.83842 WP_003406908.1.83850 WP_003406908.1.83861 WP_003406908.1.83884 WP_003406908.1.83920 WP_003406908.1.83929 WP_003406908.1.83930 WP_003406908.1.83975 WP_003406908.1.83991 WP_003406908.1.8400 WP_003406908.1.8404 WP_003406908.1.84057 WP_003406908.1.84070 WP_003406908.1.8409 WP_003406908.1.84112 WP_003406908.1.84146 WP_003406908.1.8415 WP_003406908.1.84176 WP_003406908.1.84186 WP_003406908.1.84192 WP_003406908.1.84228 WP_003406908.1.8424 WP_003406908.1.84244 WP_003406908.1.84259 WP_003406908.1.8426 WP_003406908.1.84277 WP_003406908.1.84287 WP_003406908.1.8434 WP_003406908.1.84388 WP_003406908.1.84408 WP_003406908.1.84409 WP_003406908.1.84438 WP_003406908.1.84460 WP_003406908.1.84488 WP_003406908.1.84504 WP_003406908.1.84525 WP_003406908.1.84620 WP_003406908.1.84623 WP_003406908.1.84641 WP_003406908.1.84655 WP_003406908.1.84666 WP_003406908.1.84670 WP_003406908.1.84739 WP_003406908.1.84748 WP_003406908.1.84766 WP_003406908.1.84772 WP_003406908.1.84774 WP_003406908.1.848 WP_003406908.1.84812 WP_003406908.1.84836 WP_003406908.1.84839 WP_003406908.1.84846 WP_003406908.1.84873 WP_003406908.1.84911 WP_003406908.1.84938 WP_003406908.1.84968 WP_003406908.1.84973 WP_003406908.1.84981 WP_003406908.1.84985 WP_003406908.1.8503 WP_003406908.1.85038 WP_003406908.1.85041 WP_003406908.1.85043 WP_003406908.1.8505 WP_003406908.1.85074 WP_003406908.1.8509 WP_003406908.1.8512 WP_003406908.1.85148 WP_003406908.1.8518 WP_003406908.1.8522 WP_003406908.1.85242 WP_003406908.1.85276 WP_003406908.1.85281 WP_003406908.1.85284 WP_003406908.1.85314 WP_003406908.1.85319 WP_003406908.1.85330 WP_003406908.1.85341 WP_003406908.1.85346 WP_003406908.1.8535 WP_003406908.1.85363 WP_003406908.1.85371 WP_003406908.1.85377 WP_003406908.1.85387 WP_003406908.1.85399 WP_003406908.1.85458 WP_003406908.1.8546 WP_003406908.1.85464 WP_003406908.1.85478 WP_003406908.1.85480 WP_003406908.1.85488 WP_003406908.1.85495 WP_003406908.1.85551 WP_003406908.1.85557 WP_003406908.1.85577 WP_003406908.1.85597 WP_003406908.1.85599 WP_003406908.1.85610 WP_003406908.1.8563 WP_003406908.1.85648 WP_003406908.1.85704 WP_003406908.1.85717 WP_003406908.1.85727 WP_003406908.1.85737 WP_003406908.1.85763 WP_003406908.1.85808 WP_003406908.1.85819 WP_003406908.1.85820 WP_003406908.1.85823 WP_003406908.1.85832 WP_003406908.1.8586 WP_003406908.1.85872 WP_003406908.1.85894 WP_003406908.1.85909 WP_003406908.1.85913 WP_003406908.1.85953 WP_003406908.1.85986 WP_003406908.1.86000 WP_003406908.1.86025 WP_003406908.1.86032 WP_003406908.1.86048 WP_003406908.1.86052 WP_003406908.1.86067 WP_003406908.1.86103 WP_003406908.1.86122 WP_003406908.1.86124 WP_003406908.1.86160 WP_003406908.1.86164 WP_003406908.1.86168 WP_003406908.1.86190 WP_003406908.1.86204 WP_003406908.1.86208 WP_003406908.1.86235 WP_003406908.1.86249 WP_003406908.1.86260 WP_003406908.1.86290 WP_003406908.1.863 WP_003406908.1.86327 WP_003406908.1.86334 WP_003406908.1.86337 WP_003406908.1.86368 WP_003406908.1.86377 WP_003406908.1.86425 WP_003406908.1.86459 WP_003406908.1.8649 WP_003406908.1.86499 WP_003406908.1.86520 WP_003406908.1.86561 WP_003406908.1.86568 WP_003406908.1.86575 WP_003406908.1.86584 WP_003406908.1.86605 WP_003406908.1.86626 WP_003406908.1.86648 WP_003406908.1.8666 WP_003406908.1.86684 WP_003406908.1.86696 WP_003406908.1.86705 WP_003406908.1.86718 WP_003406908.1.86725 WP_003406908.1.86757 WP_003406908.1.86766 WP_003406908.1.86801 WP_003406908.1.86814 WP_003406908.1.86820 WP_003406908.1.86825 WP_003406908.1.86834 WP_003406908.1.8685 WP_003406908.1.86851 WP_003406908.1.86855 WP_003406908.1.86867 WP_003406908.1.86877 WP_003406908.1.86883 WP_003406908.1.8689 WP_003406908.1.86892 WP_003406908.1.86933 WP_003406908.1.86941 WP_003406908.1.86950 WP_003406908.1.86962 WP_003406908.1.86963 WP_003406908.1.86979 WP_003406908.1.8700 WP_003406908.1.87001 WP_003406908.1.87002 WP_003406908.1.87031 WP_003406908.1.87116 WP_003406908.1.87117 WP_003406908.1.8714 WP_003406908.1.87162 WP_003406908.1.87178 WP_003406908.1.87191 WP_003406908.1.87201 WP_003406908.1.87209 WP_003406908.1.87240 WP_003406908.1.87266 WP_003406908.1.87273 WP_003406908.1.87275 WP_003406908.1.8733 WP_003406908.1.87345 WP_003406908.1.87369 WP_003406908.1.8737 WP_003406908.1.87401 WP_003406908.1.87404 WP_003406908.1.87409 WP_003406908.1.87444 WP_003406908.1.87446 WP_003406908.1.87459 WP_003406908.1.87472 WP_003406908.1.87489 WP_003406908.1.87494 WP_003406908.1.87496 WP_003406908.1.87582 WP_003406908.1.87588 WP_003406908.1.87617 WP_003406908.1.87619 WP_003406908.1.87620 WP_003406908.1.87634 WP_003406908.1.87643 WP_003406908.1.8765 WP_003406908.1.87650 WP_003406908.1.87654 WP_003406908.1.87658 WP_003406908.1.87665 WP_003406908.1.87676 WP_003406908.1.87677 WP_003406908.1.87684 WP_003406908.1.87692 WP_003406908.1.87707 WP_003406908.1.87732 WP_003406908.1.87784 WP_003406908.1.87796 WP_003406908.1.87809 WP_003406908.1.87817 WP_003406908.1.87827 WP_003406908.1.87831 WP_003406908.1.87835 WP_003406908.1.87837 WP_003406908.1.87866 WP_003406908.1.8789 WP_003406908.1.87911 WP_003406908.1.87924 WP_003406908.1.87951 WP_003406908.1.87955 WP_003406908.1.87956 WP_003406908.1.87991 WP_003406908.1.88 WP_003406908.1.88002 WP_003406908.1.88037 WP_003406908.1.88039 WP_003406908.1.88072 WP_003406908.1.88077 WP_003406908.1.88121 WP_003406908.1.88180 WP_003406908.1.88191 WP_003406908.1.88205 WP_003406908.1.88217 WP_003406908.1.88219 WP_003406908.1.88245 WP_003406908.1.88253 WP_003406908.1.88294 WP_003406908.1.88315 WP_003406908.1.88316 WP_003406908.1.88320 WP_003406908.1.88338 WP_003406908.1.8840 WP_003406908.1.88437 WP_003406908.1.88453 WP_003406908.1.88469 WP_003406908.1.88489 WP_003406908.1.88507 WP_003406908.1.88521 WP_003406908.1.88530 WP_003406908.1.88537 WP_003406908.1.88541 WP_003406908.1.88592 WP_003406908.1.88616 WP_003406908.1.88618 WP_003406908.1.8862 WP_003406908.1.88625 WP_003406908.1.88632 WP_003406908.1.88634 WP_003406908.1.88649 WP_003406908.1.8870 WP_003406908.1.88737 WP_003406908.1.88756 WP_003406908.1.888 WP_003406908.1.88824 WP_003406908.1.88886 WP_003406908.1.88965 WP_003406908.1.88985 WP_003406908.1.8902 WP_003406908.1.89025 WP_003406908.1.89041 WP_003406908.1.89046 WP_003406908.1.89082 WP_003406908.1.89162 WP_003406908.1.89168 WP_003406908.1.8917 WP_003406908.1.89193 WP_003406908.1.89205 WP_003406908.1.89207 WP_003406908.1.89225 WP_003406908.1.8925 WP_003406908.1.89277 WP_003406908.1.89293 WP_003406908.1.89320 WP_003406908.1.89371 WP_003406908.1.89378 WP_003406908.1.89392 WP_003406908.1.89406 WP_003406908.1.8943 WP_003406908.1.89451 WP_003406908.1.89453 WP_003406908.1.89473 WP_003406908.1.89475 WP_003406908.1.89483 WP_003406908.1.895 WP_003406908.1.89513 WP_003406908.1.89517 WP_003406908.1.89522 WP_003406908.1.8954 WP_003406908.1.89543 WP_003406908.1.89567 WP_003406908.1.8957 WP_003406908.1.89572 WP_003406908.1.89589 WP_003406908.1.89607 WP_003406908.1.89613 WP_003406908.1.89625 WP_003406908.1.8967 WP_003406908.1.89670 WP_003406908.1.89676 WP_003406908.1.89729 WP_003406908.1.89739 WP_003406908.1.89762 WP_003406908.1.8977 WP_003406908.1.89802 WP_003406908.1.89808 WP_003406908.1.8982 WP_003406908.1.89829 WP_003406908.1.89831 WP_003406908.1.89844 WP_003406908.1.89849 WP_003406908.1.8989 WP_003406908.1.89901 WP_003406908.1.89903 WP_003406908.1.89909 WP_003406908.1.89922 WP_003406908.1.89926 WP_003406908.1.89963 WP_003406908.1.89971 WP_003406908.1.8998 WP_003406908.1.900 WP_003406908.1.90048 WP_003406908.1.9007 WP_003406908.1.90080 WP_003406908.1.90130 WP_003406908.1.90134 WP_003406908.1.90137 WP_003406908.1.90157 WP_003406908.1.90184 WP_003406908.1.90199 WP_003406908.1.90231 WP_003406908.1.90245 WP_003406908.1.90308 WP_003406908.1.90322 WP_003406908.1.90328 WP_003406908.1.90372 WP_003406908.1.90439 WP_003406908.1.90481 WP_003406908.1.90499 WP_003406908.1.9050 WP_003406908.1.90527 WP_003406908.1.90550 WP_003406908.1.90560 WP_003406908.1.90612 WP_003406908.1.90640 WP_003406908.1.90672 WP_003406908.1.90687 WP_003406908.1.90691 WP_003406908.1.90711 WP_003406908.1.90722 WP_003406908.1.90744 WP_003406908.1.9075 WP_003406908.1.90756 WP_003406908.1.90767 WP_003406908.1.90771 WP_003406908.1.90785 WP_003406908.1.90788 WP_003406908.1.90800 WP_003406908.1.90810 WP_003406908.1.90816 WP_003406908.1.90819 WP_003406908.1.9082 WP_003406908.1.90831 WP_003406908.1.90884 WP_003406908.1.90899 WP_003406908.1.90906 WP_003406908.1.90958 WP_003406908.1.90976 WP_003406908.1.90977 WP_003406908.1.90987 WP_003406908.1.9102 WP_003406908.1.91026 WP_003406908.1.91032 WP_003406908.1.91043 WP_003406908.1.91053 WP_003406908.1.91082 WP_003406908.1.91106 WP_003406908.1.91112 WP_003406908.1.91144 WP_003406908.1.91151 WP_003406908.1.91157 WP_003406908.1.91167 WP_003406908.1.91169 WP_003406908.1.91192 WP_003406908.1.91201 WP_003406908.1.91207 WP_003406908.1.91208 WP_003406908.1.91211 WP_003406908.1.91214 WP_003406908.1.91230 WP_003406908.1.91244 WP_003406908.1.91251 WP_003406908.1.91260 WP_003406908.1.91265 WP_003406908.1.9128 WP_003406908.1.91284 WP_003406908.1.91294 WP_003406908.1.91303 WP_003406908.1.91322 WP_003406908.1.91352 WP_003406908.1.91386 WP_003406908.1.9139 WP_003406908.1.91398 WP_003406908.1.91411 WP_003406908.1.91430 WP_003406908.1.91436 WP_003406908.1.91483 WP_003406908.1.91496 WP_003406908.1.91507 WP_003406908.1.91508 WP_003406908.1.91576 WP_003406908.1.91589 WP_003406908.1.91694 WP_003406908.1.91695 WP_003406908.1.91717 WP_003406908.1.91728 WP_003406908.1.91743 WP_003406908.1.91759 WP_003406908.1.91784 WP_003406908.1.91785 WP_003406908.1.91786 WP_003406908.1.91802 WP_003406908.1.91822 WP_003406908.1.91828 WP_003406908.1.9189 WP_003406908.1.91896 WP_003406908.1.9190 WP_003406908.1.91915 WP_003406908.1.91931 WP_003406908.1.91937 WP_003406908.1.91944 WP_003406908.1.91953 WP_003406908.1.91957 WP_003406908.1.91976 WP_003406908.1.91978 WP_003406908.1.92021 WP_003406908.1.92083 WP_003406908.1.92127 WP_003406908.1.92144 WP_003406908.1.92150 WP_003406908.1.92153 WP_003406908.1.92190 WP_003406908.1.92192 WP_003406908.1.92200 WP_003406908.1.92220 WP_003406908.1.92221 WP_003406908.1.92222 WP_003406908.1.92273 WP_003406908.1.92289 WP_003406908.1.9229 WP_003406908.1.92294 WP_003406908.1.92300 WP_003406908.1.92317 WP_003406908.1.92334 WP_003406908.1.92338 WP_003406908.1.92345 WP_003406908.1.92356 WP_003406908.1.92364 WP_003406908.1.92380 WP_003406908.1.92416 WP_003406908.1.92428 WP_003406908.1.92447 WP_003406908.1.92456 WP_003406908.1.92467 WP_003406908.1.92471 WP_003406908.1.92490 WP_003406908.1.92508 WP_003406908.1.9251 WP_003406908.1.92511 WP_003406908.1.92523 WP_003406908.1.92527 WP_003406908.1.92536 WP_003406908.1.92592 WP_003406908.1.92597 WP_003406908.1.92603 WP_003406908.1.92606 WP_003406908.1.92610 WP_003406908.1.92613 WP_003406908.1.9263 WP_003406908.1.9265 WP_003406908.1.92650 WP_003406908.1.92660 WP_003406908.1.92677 WP_003406908.1.92685 WP_003406908.1.92689 WP_003406908.1.92690 WP_003406908.1.92714 WP_003406908.1.92736 WP_003406908.1.9274 WP_003406908.1.92752 WP_003406908.1.92777 WP_003406908.1.92803 WP_003406908.1.92856 WP_003406908.1.92881 WP_003406908.1.92892 WP_003406908.1.92907 WP_003406908.1.92908 WP_003406908.1.9291 WP_003406908.1.92917 WP_003406908.1.92996 WP_003406908.1.93006 WP_003406908.1.93008 WP_003406908.1.93015 WP_003406908.1.93043 WP_003406908.1.9307 WP_003406908.1.93083 WP_003406908.1.93097 WP_003406908.1.93137 WP_003406908.1.93192 WP_003406908.1.93199 WP_003406908.1.93203 WP_003406908.1.93212 WP_003406908.1.93234 WP_003406908.1.93245 WP_003406908.1.93257 WP_003406908.1.93265 WP_003406908.1.93297 WP_003406908.1.93320 WP_003406908.1.93328 WP_003406908.1.93337 WP_003406908.1.93343 WP_003406908.1.93349 WP_003406908.1.93363 WP_003406908.1.93377 WP_003406908.1.9338 WP_003406908.1.93407 WP_003406908.1.93417 WP_003406908.1.93419 WP_003406908.1.9344 WP_003406908.1.93443 WP_003406908.1.93447 WP_003406908.1.93470 WP_003406908.1.93483 WP_003406908.1.93487 WP_003406908.1.93495 WP_003406908.1.93499 WP_003406908.1.93516 WP_003406908.1.93536 WP_003406908.1.93544 WP_003406908.1.93555 WP_003406908.1.93560 WP_003406908.1.93564 WP_003406908.1.9357 WP_003406908.1.93573 WP_003406908.1.93576 WP_003406908.1.93588 WP_003406908.1.9363 WP_003406908.1.93645 WP_003406908.1.93649 WP_003406908.1.93659 WP_003406908.1.93677 WP_003406908.1.9368 WP_003406908.1.93689 WP_003406908.1.93693 WP_003406908.1.93698 WP_003406908.1.93706 WP_003406908.1.9371 WP_003406908.1.93792 WP_003406908.1.93823 WP_003406908.1.93871 WP_003406908.1.9388 WP_003406908.1.93894 WP_003406908.1.93903 WP_003406908.1.93913 WP_003406908.1.93946 WP_003406908.1.93953 WP_003406908.1.93954 WP_003406908.1.93988 WP_003406908.1.9407 WP_003406908.1.94143 WP_003406908.1.94154 WP_003406908.1.94184 WP_003406908.1.94204 WP_003406908.1.94205 WP_003406908.1.94226 WP_003406908.1.94231 WP_003406908.1.94256 WP_003406908.1.94261 WP_003406908.1.94281 WP_003406908.1.94292 WP_003406908.1.94297 WP_003406908.1.9431 WP_003406908.1.94326 WP_003406908.1.94339 WP_003406908.1.94392 WP_003406908.1.94416 WP_003406908.1.94421 WP_003406908.1.94456 WP_003406908.1.94470 WP_003406908.1.94480 WP_003406908.1.94495 WP_003406908.1.94511 WP_003406908.1.94512 WP_003406908.1.94525 WP_003406908.1.94528 WP_003406908.1.94564 WP_003406908.1.946 WP_003406908.1.94602 WP_003406908.1.94623 WP_003406908.1.94629 WP_003406908.1.9465 WP_003406908.1.94673 WP_003406908.1.94714 WP_003406908.1.94730 WP_003406908.1.94736 WP_003406908.1.94776 WP_003406908.1.9478 WP_003406908.1.94834 WP_003406908.1.94852 WP_003406908.1.94872 WP_003406908.1.9488 WP_003406908.1.94902 WP_003406908.1.94916 WP_003406908.1.94979 WP_003406908.1.94994 WP_003406908.1.94996 WP_003406908.1.94998 WP_003406908.1.95007 WP_003406908.1.95010 WP_003406908.1.95015 WP_003406908.1.95034 WP_003406908.1.95068 WP_003406908.1.95081 WP_003406908.1.95082 WP_003406908.1.9509 WP_003406908.1.95096 WP_003406908.1.95112 WP_003406908.1.95138 WP_003406908.1.9514 WP_003406908.1.95179 WP_003406908.1.95188 WP_003406908.1.95190 WP_003406908.1.95234 WP_003406908.1.95241 WP_003406908.1.95245 WP_003406908.1.95257 WP_003406908.1.95279 WP_003406908.1.9531 WP_003406908.1.95335 WP_003406908.1.95344 WP_003406908.1.9535 WP_003406908.1.95370 WP_003406908.1.95392 WP_003406908.1.95416 WP_003406908.1.95417 WP_003406908.1.95454 WP_003406908.1.95455 WP_003406908.1.95491 WP_003406908.1.95497 WP_003406908.1.95508 WP_003406908.1.95509 WP_003406908.1.95529 WP_003406908.1.95556 WP_003406908.1.95557 WP_003406908.1.95565 WP_003406908.1.95578 WP_003406908.1.95580 WP_003406908.1.95585 WP_003406908.1.95643 WP_003406908.1.95679 WP_003406908.1.95685 WP_003406908.1.957 WP_003406908.1.95724 WP_003406908.1.95727 WP_003406908.1.95735 WP_003406908.1.95758 WP_003406908.1.95772 WP_003406908.1.95797 WP_003406908.1.95839 WP_003406908.1.9585 WP_003406908.1.9590 WP_003406908.1.95902 WP_003406908.1.95908 WP_003406908.1.95924 WP_003406908.1.95926 WP_003406908.1.95953 WP_003406908.1.95958 WP_003406908.1.95964 WP_003406908.1.95973 WP_003406908.1.96006 WP_003406908.1.9602 WP_003406908.1.96036 WP_003406908.1.96062 WP_003406908.1.96065 WP_003406908.1.96098 WP_003406908.1.96146 WP_003406908.1.96166 WP_003406908.1.96171 WP_003406908.1.96182 WP_003406908.1.96204 WP_003406908.1.96230 WP_003406908.1.96235 WP_003406908.1.96242 WP_003406908.1.96245 WP_003406908.1.96254 WP_003406908.1.96259 WP_003406908.1.96286 WP_003406908.1.96313 WP_003406908.1.96318 WP_003406908.1.96345 WP_003406908.1.96360 WP_003406908.1.96373 WP_003406908.1.96456 WP_003406908.1.96486 WP_003406908.1.96560 WP_003406908.1.96569 WP_003406908.1.96573 WP_003406908.1.96575 WP_003406908.1.96576 WP_003406908.1.96611 WP_003406908.1.96621 WP_003406908.1.9667 WP_003406908.1.96681 WP_003406908.1.96726 WP_003406908.1.96733 WP_003406908.1.96742 WP_003406908.1.9678 WP_003406908.1.9685 WP_003406908.1.97008 WP_003406908.1.97009 WP_003406908.1.97056 WP_003406908.1.97084 WP_003406908.1.97087 WP_003406908.1.97096 WP_003406908.1.97099 WP_003406908.1.97108 WP_003406908.1.97113 WP_003406908.1.97122 WP_003406908.1.97127 WP_003406908.1.97129 WP_003406908.1.97136 WP_003406908.1.9716 WP_003406908.1.97176 WP_003406908.1.97222 WP_003406908.1.97223 WP_003406908.1.97237 WP_003406908.1.97270 WP_003406908.1.97283 WP_003406908.1.97296 WP_003406908.1.97321 WP_003406908.1.97325 WP_003406908.1.97330 WP_003406908.1.97366 WP_003406908.1.97376 WP_003406908.1.97380 WP_003406908.1.9739 WP_003406908.1.97462 WP_003406908.1.97517 WP_003406908.1.97519 WP_003406908.1.97535 WP_003406908.1.97540 WP_003406908.1.97545 WP_003406908.1.97546 WP_003406908.1.97550 WP_003406908.1.97568 WP_003406908.1.97577 WP_003406908.1.97584 WP_003406908.1.9759 WP_003406908.1.97591 WP_003406908.1.97596 WP_003406908.1.97609 WP_003406908.1.97618 WP_003406908.1.9763 WP_003406908.1.97669 WP_003406908.1.97673 WP_003406908.1.97700 WP_003406908.1.9773 WP_003406908.1.97730 WP_003406908.1.97740 WP_003406908.1.97751 WP_003406908.1.97754 WP_003406908.1.97797 WP_003406908.1.9782 WP_003406908.1.9784 WP_003406908.1.97888 WP_003406908.1.9795 WP_003406908.1.97951 WP_003406908.1.97958 WP_003406908.1.97966 WP_003406908.1.97977 WP_003406908.1.97979 WP_003406908.1.97995 WP_003406908.1.98018 WP_003406908.1.98034 WP_003406908.1.98052 WP_003406908.1.98071 WP_003406908.1.98113 WP_003406908.1.98114 WP_003406908.1.98128 WP_003406908.1.98181 WP_003406908.1.98188 WP_003406908.1.98189 WP_003406908.1.98213 WP_003406908.1.98225 WP_003406908.1.98291 WP_003406908.1.98335 WP_003406908.1.98350 WP_003406908.1.98395 WP_003406908.1.98412 WP_003406908.1.98441 WP_003406908.1.98443 WP_003406908.1.98462 WP_003406908.1.9848 WP_003406908.1.98482 WP_003406908.1.98486 WP_003406908.1.98488 WP_003406908.1.98503 WP_003406908.1.98516 WP_003406908.1.98524 WP_003406908.1.98536 WP_003406908.1.98541 WP_003406908.1.98566 WP_003406908.1.98576 WP_003406908.1.98590 WP_003406908.1.98594 WP_003406908.1.98599 WP_003406908.1.98629 WP_003406908.1.98645 WP_003406908.1.98646 WP_003406908.1.98649 WP_003406908.1.98656 WP_003406908.1.9867 WP_003406908.1.98674 WP_003406908.1.98697 WP_003406908.1.98701 WP_003406908.1.98739 WP_003406908.1.98749 WP_003406908.1.98765 WP_003406908.1.98770 WP_003406908.1.98777 WP_003406908.1.98778 WP_003406908.1.98802 WP_003406908.1.98838 WP_003406908.1.98850 WP_003406908.1.98906 WP_003406908.1.98935 WP_003406908.1.98948 WP_003406908.1.98953 WP_003406908.1.98984 WP_003406908.1.99000 WP_003406908.1.99023 WP_003406908.1.99030 WP_003406908.1.99037 WP_003406908.1.99055 WP_003406908.1.99062 WP_003406908.1.99086 WP_003406908.1.99115 WP_003406908.1.99117 WP_003406908.1.99161 WP_003406908.1.99176 WP_003406908.1.99205 WP_003406908.1.99211 WP_003406908.1.99216 WP_003406908.1.99222 WP_003406908.1.99251 WP_003406908.1.99269 WP_003406908.1.99294 WP_003406908.1.99312 WP_003406908.1.99315 WP_003406908.1.99316 WP_003406908.1.99322 WP_003406908.1.99328 WP_003406908.1.99365 WP_003406908.1.99368 WP_003406908.1.99379 WP_003406908.1.99396 WP_003406908.1.99402 WP_003406908.1.99419 WP_003406908.1.99438 WP_003406908.1.99460 WP_003406908.1.99468 WP_003406908.1.99473 WP_003406908.1.99513 WP_003406908.1.99529 WP_003406908.1.99548 WP_003406908.1.99572 WP_003406908.1.99575 WP_003406908.1.99578 WP_003406908.1.99605 WP_003406908.1.99609 WP_003406908.1.99617 WP_003406908.1.99635 WP_003406908.1.99650 WP_003406908.1.99672 WP_003406908.1.99701 WP_003406908.1.99711 WP_003406908.1.99716 WP_003406908.1.99740 WP_003406908.1.99745 WP_003406908.1.99749 WP_003406908.1.9976 WP_003406908.1.99798 WP_003406908.1.99817 WP_003406908.1.99832 WP_003406908.1.99847 WP_003406908.1.99852 WP_003406908.1.99886 WP_003406908.1.99897 WP_003406908.1.99899 WP_003406908.1.99915 WP_003406908.1.9993 WP_003406908.1.99982 WP_003406908.1.99991 gi|15608473|ref|NP_215849.1| gi|449063407|ref|YP_007430490.1| gi|15608473|ref|NP_215849.1| gi|339631402|ref|YP_004723044.1| gi|506925804|ref|YP_008006254.1| gi|392433071|ref|YP_006474115.1| gi|392386024|ref|YP_005307653.1| gi|15840788|ref|NP_335825.1| gi|471337256|ref|YP_007609969.1| gi|494699743|ref|YP_007965225.1| gi|148822556|ref|YP_001287310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]