SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15608561|ref|NP_215939.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15608561|ref|NP_215939.1|
Domain Number - Region: 38-80
Classification Level Classification E-value
Superfamily SP0830-like 0.0196
Family SP0830-like 0.046
Further Details:      
 
Domain Number - Region: 116-214
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0646
Family Intein endonuclease 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15608561|ref|NP_215939.1|
Sequence length 325
Comment Probable transcriptional regulatory protein WhiA [Mycobacterium tuberculosis H37Rv]
Sequence
MTTDVKDELSRLVVKSVSARRAEVTSLLRFAGGLHIVGGRVVVEAELDLGSIARRLRKEI
FELYGYTAVVHVLSASGIRKSTRYVLRVANDGEALARQTGLLDMRGRPVRGLPAQVVGGS
IDDAEAAWRGAFLAHGSLTEPGRSSALEVSCPGPEAALALVGAARRLGVGAKAREVRGAD
RVVVRDGEAIGALLTRMGAQDTRLVWEERRLRREVRATANRLANFDDANLRRSARAAVAA
AARVERALEILGDTVPEHLASAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLLSM
ADRKAKVDGIPDTESVVTPDLLEDA
Download sequence
Identical sequences A0A045H462 A0A0H3L8D4 A0A0Y1BR84 A0A109SMM9 A0A243QQA6 A1KIL2 C1AN68 G0TIM7 Q7U040
gi|15608561|ref|NP_215939.1| gi|148822643|ref|YP_001287397.1| gi|479055386|ref|YP_007351192.1| gi|544161657|ref|YP_002161436.2| gi|375296770|ref|YP_005101037.1| gi|148661214|ref|YP_001282737.1| gi|31792617|ref|NP_855110.1| gi|392386111|ref|YP_005307740.1| NP_215939.1.84033 WP_003901156.1.100000 WP_003901156.1.100021 WP_003901156.1.100069 WP_003901156.1.100087 WP_003901156.1.10015 WP_003901156.1.100208 WP_003901156.1.100216 WP_003901156.1.10022 WP_003901156.1.100255 WP_003901156.1.100260 WP_003901156.1.100270 WP_003901156.1.100279 WP_003901156.1.100286 WP_003901156.1.100308 WP_003901156.1.100309 WP_003901156.1.100318 WP_003901156.1.100337 WP_003901156.1.100338 WP_003901156.1.10037 WP_003901156.1.100383 WP_003901156.1.100396 WP_003901156.1.1004 WP_003901156.1.100401 WP_003901156.1.100459 WP_003901156.1.100460 WP_003901156.1.100552 WP_003901156.1.100581 WP_003901156.1.100600 WP_003901156.1.100625 WP_003901156.1.10064 WP_003901156.1.100666 WP_003901156.1.100671 WP_003901156.1.100677 WP_003901156.1.100682 WP_003901156.1.100697 WP_003901156.1.100703 WP_003901156.1.100716 WP_003901156.1.100722 WP_003901156.1.100754 WP_003901156.1.100757 WP_003901156.1.100772 WP_003901156.1.1008 WP_003901156.1.100812 WP_003901156.1.100845 WP_003901156.1.100866 WP_003901156.1.10088 WP_003901156.1.100889 WP_003901156.1.10090 WP_003901156.1.100910 WP_003901156.1.100915 WP_003901156.1.100918 WP_003901156.1.100935 WP_003901156.1.100984 WP_003901156.1.100992 WP_003901156.1.100998 WP_003901156.1.101 WP_003901156.1.101025 WP_003901156.1.101028 WP_003901156.1.10104 WP_003901156.1.101048 WP_003901156.1.101054 WP_003901156.1.101075 WP_003901156.1.101143 WP_003901156.1.101146 WP_003901156.1.10116 WP_003901156.1.10117 WP_003901156.1.101209 WP_003901156.1.10125 WP_003901156.1.101290 WP_003901156.1.101323 WP_003901156.1.101324 WP_003901156.1.101350 WP_003901156.1.101367 WP_003901156.1.101398 WP_003901156.1.101403 WP_003901156.1.101421 WP_003901156.1.10144 WP_003901156.1.101442 WP_003901156.1.10145 WP_003901156.1.101452 WP_003901156.1.101456 WP_003901156.1.101481 WP_003901156.1.101493 WP_003901156.1.101496 WP_003901156.1.101525 WP_003901156.1.101533 WP_003901156.1.101535 WP_003901156.1.101553 WP_003901156.1.101558 WP_003901156.1.10156 WP_003901156.1.101573 WP_003901156.1.101576 WP_003901156.1.10159 WP_003901156.1.101592 WP_003901156.1.101604 WP_003901156.1.101607 WP_003901156.1.101622 WP_003901156.1.101644 WP_003901156.1.101659 WP_003901156.1.101671 WP_003901156.1.101687 WP_003901156.1.101698 WP_003901156.1.10170 WP_003901156.1.101713 WP_003901156.1.101722 WP_003901156.1.101733 WP_003901156.1.101743 WP_003901156.1.101753 WP_003901156.1.101754 WP_003901156.1.101764 WP_003901156.1.101773 WP_003901156.1.101795 WP_003901156.1.101797 WP_003901156.1.101798 WP_003901156.1.101802 WP_003901156.1.101826 WP_003901156.1.101836 WP_003901156.1.101858 WP_003901156.1.101859 WP_003901156.1.101862 WP_003901156.1.101888 WP_003901156.1.101894 WP_003901156.1.101899 WP_003901156.1.1019 WP_003901156.1.101923 WP_003901156.1.101925 WP_003901156.1.10193 WP_003901156.1.101996 WP_003901156.1.102 WP_003901156.1.102008 WP_003901156.1.102017 WP_003901156.1.102053 WP_003901156.1.102055 WP_003901156.1.102063 WP_003901156.1.102099 WP_003901156.1.1021 WP_003901156.1.10211 WP_003901156.1.102119 WP_003901156.1.102121 WP_003901156.1.102143 WP_003901156.1.10224 WP_003901156.1.10253 WP_003901156.1.10262 WP_003901156.1.10272 WP_003901156.1.10277 WP_003901156.1.1033 WP_003901156.1.10350 WP_003901156.1.10362 WP_003901156.1.10366 WP_003901156.1.10376 WP_003901156.1.10396 WP_003901156.1.10410 WP_003901156.1.10421 WP_003901156.1.10430 WP_003901156.1.1044 WP_003901156.1.10440 WP_003901156.1.10445 WP_003901156.1.10471 WP_003901156.1.10472 WP_003901156.1.10489 WP_003901156.1.105 WP_003901156.1.10518 WP_003901156.1.10523 WP_003901156.1.10545 WP_003901156.1.1057 WP_003901156.1.10594 WP_003901156.1.10603 WP_003901156.1.10606 WP_003901156.1.10615 WP_003901156.1.10623 WP_003901156.1.10635 WP_003901156.1.10643 WP_003901156.1.10648 WP_003901156.1.10662 WP_003901156.1.10709 WP_003901156.1.10735 WP_003901156.1.10740 WP_003901156.1.10756 WP_003901156.1.1078 WP_003901156.1.10791 WP_003901156.1.10799 WP_003901156.1.10825 WP_003901156.1.10848 WP_003901156.1.10863 WP_003901156.1.10879 WP_003901156.1.10912 WP_003901156.1.10916 WP_003901156.1.10923 WP_003901156.1.10927 WP_003901156.1.1095 WP_003901156.1.10956 WP_003901156.1.10958 WP_003901156.1.10962 WP_003901156.1.10980 WP_003901156.1.10981 WP_003901156.1.10993 WP_003901156.1.11040 WP_003901156.1.11061 WP_003901156.1.11070 WP_003901156.1.11141 WP_003901156.1.11171 WP_003901156.1.11175 WP_003901156.1.11176 WP_003901156.1.11222 WP_003901156.1.11236 WP_003901156.1.11329 WP_003901156.1.1133 WP_003901156.1.11342 WP_003901156.1.11373 WP_003901156.1.11376 WP_003901156.1.11390 WP_003901156.1.11402 WP_003901156.1.11481 WP_003901156.1.11487 WP_003901156.1.11489 WP_003901156.1.11491 WP_003901156.1.11514 WP_003901156.1.11587 WP_003901156.1.11589 WP_003901156.1.11596 WP_003901156.1.11604 WP_003901156.1.11610 WP_003901156.1.11697 WP_003901156.1.11707 WP_003901156.1.11752 WP_003901156.1.11758 WP_003901156.1.11761 WP_003901156.1.11775 WP_003901156.1.11804 WP_003901156.1.11822 WP_003901156.1.11826 WP_003901156.1.11856 WP_003901156.1.11906 WP_003901156.1.11939 WP_003901156.1.11960 WP_003901156.1.11961 WP_003901156.1.11972 WP_003901156.1.11984 WP_003901156.1.120 WP_003901156.1.12001 WP_003901156.1.12049 WP_003901156.1.12052 WP_003901156.1.12100 WP_003901156.1.12116 WP_003901156.1.12130 WP_003901156.1.12133 WP_003901156.1.12161 WP_003901156.1.12165 WP_003901156.1.12184 WP_003901156.1.12187 WP_003901156.1.12190 WP_003901156.1.12216 WP_003901156.1.12265 WP_003901156.1.12275 WP_003901156.1.12293 WP_003901156.1.12294 WP_003901156.1.123 WP_003901156.1.1231 WP_003901156.1.12314 WP_003901156.1.12327 WP_003901156.1.12338 WP_003901156.1.1236 WP_003901156.1.12371 WP_003901156.1.12372 WP_003901156.1.12389 WP_003901156.1.12406 WP_003901156.1.1241 WP_003901156.1.12421 WP_003901156.1.12424 WP_003901156.1.12446 WP_003901156.1.12464 WP_003901156.1.12479 WP_003901156.1.12519 WP_003901156.1.12523 WP_003901156.1.12526 WP_003901156.1.1255 WP_003901156.1.12550 WP_003901156.1.12551 WP_003901156.1.12563 WP_003901156.1.12611 WP_003901156.1.12669 WP_003901156.1.1267 WP_003901156.1.12672 WP_003901156.1.12692 WP_003901156.1.1271 WP_003901156.1.12768 WP_003901156.1.1279 WP_003901156.1.12794 WP_003901156.1.12801 WP_003901156.1.12804 WP_003901156.1.12821 WP_003901156.1.12841 WP_003901156.1.12854 WP_003901156.1.12871 WP_003901156.1.12901 WP_003901156.1.12941 WP_003901156.1.12947 WP_003901156.1.12957 WP_003901156.1.12972 WP_003901156.1.13028 WP_003901156.1.13043 WP_003901156.1.13086 WP_003901156.1.13087 WP_003901156.1.13090 WP_003901156.1.13096 WP_003901156.1.13163 WP_003901156.1.13175 WP_003901156.1.13183 WP_003901156.1.132 WP_003901156.1.13249 WP_003901156.1.13282 WP_003901156.1.13284 WP_003901156.1.13296 WP_003901156.1.13298 WP_003901156.1.13302 WP_003901156.1.13306 WP_003901156.1.13312 WP_003901156.1.13313 WP_003901156.1.13321 WP_003901156.1.13345 WP_003901156.1.13358 WP_003901156.1.13375 WP_003901156.1.1338 WP_003901156.1.13420 WP_003901156.1.13433 WP_003901156.1.13435 WP_003901156.1.13438 WP_003901156.1.13461 WP_003901156.1.13466 WP_003901156.1.13489 WP_003901156.1.13526 WP_003901156.1.13551 WP_003901156.1.13561 WP_003901156.1.13564 WP_003901156.1.13579 WP_003901156.1.13647 WP_003901156.1.13687 WP_003901156.1.13697 WP_003901156.1.13719 WP_003901156.1.13763 WP_003901156.1.1377 WP_003901156.1.13774 WP_003901156.1.13786 WP_003901156.1.13793 WP_003901156.1.13794 WP_003901156.1.13817 WP_003901156.1.13834 WP_003901156.1.13866 WP_003901156.1.13880 WP_003901156.1.13899 WP_003901156.1.13909 WP_003901156.1.13910 WP_003901156.1.13919 WP_003901156.1.13920 WP_003901156.1.13952 WP_003901156.1.13953 WP_003901156.1.13962 WP_003901156.1.1398 WP_003901156.1.13988 WP_003901156.1.14027 WP_003901156.1.14046 WP_003901156.1.14115 WP_003901156.1.1415 WP_003901156.1.14152 WP_003901156.1.14158 WP_003901156.1.14162 WP_003901156.1.14175 WP_003901156.1.14178 WP_003901156.1.14194 WP_003901156.1.14195 WP_003901156.1.14208 WP_003901156.1.14238 WP_003901156.1.14266 WP_003901156.1.14273 WP_003901156.1.14303 WP_003901156.1.14306 WP_003901156.1.14307 WP_003901156.1.14310 WP_003901156.1.14341 WP_003901156.1.14382 WP_003901156.1.14416 WP_003901156.1.14428 WP_003901156.1.14441 WP_003901156.1.14469 WP_003901156.1.14477 WP_003901156.1.14504 WP_003901156.1.14514 WP_003901156.1.1452 WP_003901156.1.14527 WP_003901156.1.1454 WP_003901156.1.14544 WP_003901156.1.14551 WP_003901156.1.14561 WP_003901156.1.14573 WP_003901156.1.1462 WP_003901156.1.14658 WP_003901156.1.14667 WP_003901156.1.14668 WP_003901156.1.14675 WP_003901156.1.14694 WP_003901156.1.14695 WP_003901156.1.14709 WP_003901156.1.14766 WP_003901156.1.14783 WP_003901156.1.14865 WP_003901156.1.14872 WP_003901156.1.14905 WP_003901156.1.14926 WP_003901156.1.14951 WP_003901156.1.14955 WP_003901156.1.15003 WP_003901156.1.15009 WP_003901156.1.15028 WP_003901156.1.15040 WP_003901156.1.15052 WP_003901156.1.15065 WP_003901156.1.15072 WP_003901156.1.15089 WP_003901156.1.1509 WP_003901156.1.15126 WP_003901156.1.15131 WP_003901156.1.15168 WP_003901156.1.15172 WP_003901156.1.15174 WP_003901156.1.15187 WP_003901156.1.15196 WP_003901156.1.15210 WP_003901156.1.15216 WP_003901156.1.15217 WP_003901156.1.1523 WP_003901156.1.15232 WP_003901156.1.15238 WP_003901156.1.15240 WP_003901156.1.15253 WP_003901156.1.15267 WP_003901156.1.1527 WP_003901156.1.15292 WP_003901156.1.15299 WP_003901156.1.15302 WP_003901156.1.15322 WP_003901156.1.1534 WP_003901156.1.15345 WP_003901156.1.15365 WP_003901156.1.15386 WP_003901156.1.15387 WP_003901156.1.15442 WP_003901156.1.15447 WP_003901156.1.15449 WP_003901156.1.15477 WP_003901156.1.15481 WP_003901156.1.15492 WP_003901156.1.15511 WP_003901156.1.15512 WP_003901156.1.15558 WP_003901156.1.15559 WP_003901156.1.15566 WP_003901156.1.15599 WP_003901156.1.1560 WP_003901156.1.15611 WP_003901156.1.1563 WP_003901156.1.15633 WP_003901156.1.15643 WP_003901156.1.15688 WP_003901156.1.15755 WP_003901156.1.15763 WP_003901156.1.15774 WP_003901156.1.1578 WP_003901156.1.15780 WP_003901156.1.15827 WP_003901156.1.15834 WP_003901156.1.15842 WP_003901156.1.15853 WP_003901156.1.15870 WP_003901156.1.15877 WP_003901156.1.15893 WP_003901156.1.15896 WP_003901156.1.15926 WP_003901156.1.15933 WP_003901156.1.15946 WP_003901156.1.15958 WP_003901156.1.15973 WP_003901156.1.15987 WP_003901156.1.15993 WP_003901156.1.16009 WP_003901156.1.16025 WP_003901156.1.16043 WP_003901156.1.16066 WP_003901156.1.16069 WP_003901156.1.16077 WP_003901156.1.16106 WP_003901156.1.16108 WP_003901156.1.16110 WP_003901156.1.16130 WP_003901156.1.16136 WP_003901156.1.16139 WP_003901156.1.16141 WP_003901156.1.16143 WP_003901156.1.1630 WP_003901156.1.16318 WP_003901156.1.1632 WP_003901156.1.16327 WP_003901156.1.16334 WP_003901156.1.16341 WP_003901156.1.16345 WP_003901156.1.16374 WP_003901156.1.16384 WP_003901156.1.16386 WP_003901156.1.164 WP_003901156.1.1642 WP_003901156.1.16424 WP_003901156.1.16426 WP_003901156.1.16431 WP_003901156.1.16438 WP_003901156.1.1644 WP_003901156.1.16442 WP_003901156.1.16448 WP_003901156.1.16451 WP_003901156.1.16476 WP_003901156.1.16480 WP_003901156.1.16494 WP_003901156.1.1652 WP_003901156.1.16549 WP_003901156.1.16560 WP_003901156.1.16598 WP_003901156.1.16609 WP_003901156.1.16619 WP_003901156.1.16620 WP_003901156.1.16622 WP_003901156.1.16637 WP_003901156.1.1669 WP_003901156.1.16707 WP_003901156.1.16724 WP_003901156.1.16731 WP_003901156.1.16743 WP_003901156.1.1683 WP_003901156.1.16837 WP_003901156.1.16852 WP_003901156.1.16937 WP_003901156.1.16940 WP_003901156.1.16950 WP_003901156.1.16959 WP_003901156.1.16968 WP_003901156.1.1697 WP_003901156.1.16973 WP_003901156.1.16977 WP_003901156.1.16987 WP_003901156.1.17005 WP_003901156.1.17006 WP_003901156.1.17010 WP_003901156.1.17015 WP_003901156.1.17019 WP_003901156.1.17039 WP_003901156.1.17041 WP_003901156.1.17052 WP_003901156.1.17057 WP_003901156.1.17062 WP_003901156.1.1707 WP_003901156.1.17094 WP_003901156.1.17130 WP_003901156.1.17138 WP_003901156.1.17147 WP_003901156.1.17167 WP_003901156.1.17224 WP_003901156.1.17251 WP_003901156.1.17288 WP_003901156.1.17304 WP_003901156.1.17314 WP_003901156.1.17345 WP_003901156.1.17381 WP_003901156.1.17391 WP_003901156.1.17412 WP_003901156.1.1743 WP_003901156.1.17440 WP_003901156.1.17466 WP_003901156.1.17477 WP_003901156.1.17483 WP_003901156.1.17505 WP_003901156.1.17527 WP_003901156.1.17535 WP_003901156.1.17540 WP_003901156.1.17553 WP_003901156.1.17558 WP_003901156.1.17599 WP_003901156.1.17635 WP_003901156.1.17655 WP_003901156.1.17679 WP_003901156.1.1768 WP_003901156.1.17687 WP_003901156.1.17700 WP_003901156.1.17710 WP_003901156.1.17713 WP_003901156.1.17722 WP_003901156.1.17746 WP_003901156.1.17788 WP_003901156.1.17798 WP_003901156.1.17803 WP_003901156.1.17816 WP_003901156.1.17821 WP_003901156.1.17830 WP_003901156.1.17868 WP_003901156.1.17878 WP_003901156.1.1792 WP_003901156.1.17923 WP_003901156.1.1795 WP_003901156.1.17955 WP_003901156.1.17973 WP_003901156.1.18009 WP_003901156.1.18013 WP_003901156.1.18033 WP_003901156.1.18057 WP_003901156.1.18065 WP_003901156.1.18070 WP_003901156.1.18116 WP_003901156.1.18120 WP_003901156.1.18126 WP_003901156.1.1817 WP_003901156.1.18170 WP_003901156.1.18206 WP_003901156.1.18216 WP_003901156.1.18240 WP_003901156.1.18257 WP_003901156.1.18297 WP_003901156.1.18306 WP_003901156.1.18364 WP_003901156.1.18399 WP_003901156.1.18411 WP_003901156.1.18444 WP_003901156.1.18448 WP_003901156.1.18467 WP_003901156.1.18476 WP_003901156.1.18522 WP_003901156.1.18580 WP_003901156.1.18582 WP_003901156.1.18587 WP_003901156.1.186 WP_003901156.1.18601 WP_003901156.1.18639 WP_003901156.1.18646 WP_003901156.1.18647 WP_003901156.1.1868 WP_003901156.1.18694 WP_003901156.1.18710 WP_003901156.1.18751 WP_003901156.1.18781 WP_003901156.1.18793 WP_003901156.1.18804 WP_003901156.1.18816 WP_003901156.1.18823 WP_003901156.1.18827 WP_003901156.1.18838 WP_003901156.1.18849 WP_003901156.1.18856 WP_003901156.1.18945 WP_003901156.1.1898 WP_003901156.1.19005 WP_003901156.1.19056 WP_003901156.1.19063 WP_003901156.1.19066 WP_003901156.1.19071 WP_003901156.1.19085 WP_003901156.1.19094 WP_003901156.1.19144 WP_003901156.1.19159 WP_003901156.1.19193 WP_003901156.1.19231 WP_003901156.1.19243 WP_003901156.1.19264 WP_003901156.1.19295 WP_003901156.1.19307 WP_003901156.1.19326 WP_003901156.1.1933 WP_003901156.1.19382 WP_003901156.1.19400 WP_003901156.1.19426 WP_003901156.1.19429 WP_003901156.1.19464 WP_003901156.1.19480 WP_003901156.1.19512 WP_003901156.1.19553 WP_003901156.1.19562 WP_003901156.1.19564 WP_003901156.1.19568 WP_003901156.1.19572 WP_003901156.1.19595 WP_003901156.1.19596 WP_003901156.1.19600 WP_003901156.1.19630 WP_003901156.1.1967 WP_003901156.1.19694 WP_003901156.1.1970 WP_003901156.1.19707 WP_003901156.1.19742 WP_003901156.1.19785 WP_003901156.1.19820 WP_003901156.1.19868 WP_003901156.1.19874 WP_003901156.1.19890 WP_003901156.1.19900 WP_003901156.1.19922 WP_003901156.1.19936 WP_003901156.1.19946 WP_003901156.1.19949 WP_003901156.1.19960 WP_003901156.1.19964 WP_003901156.1.20007 WP_003901156.1.20016 WP_003901156.1.20028 WP_003901156.1.2003 WP_003901156.1.20037 WP_003901156.1.20039 WP_003901156.1.20082 WP_003901156.1.20085 WP_003901156.1.20097 WP_003901156.1.20116 WP_003901156.1.20130 WP_003901156.1.20140 WP_003901156.1.20141 WP_003901156.1.20142 WP_003901156.1.20158 WP_003901156.1.20239 WP_003901156.1.20243 WP_003901156.1.20259 WP_003901156.1.20262 WP_003901156.1.20268 WP_003901156.1.20272 WP_003901156.1.20273 WP_003901156.1.20280 WP_003901156.1.20294 WP_003901156.1.20300 WP_003901156.1.20309 WP_003901156.1.20322 WP_003901156.1.2037 WP_003901156.1.20372 WP_003901156.1.20381 WP_003901156.1.204 WP_003901156.1.20427 WP_003901156.1.20432 WP_003901156.1.20457 WP_003901156.1.20459 WP_003901156.1.20460 WP_003901156.1.20542 WP_003901156.1.20578 WP_003901156.1.20608 WP_003901156.1.20624 WP_003901156.1.20628 WP_003901156.1.2066 WP_003901156.1.20707 WP_003901156.1.20722 WP_003901156.1.20729 WP_003901156.1.20742 WP_003901156.1.20751 WP_003901156.1.20776 WP_003901156.1.20843 WP_003901156.1.20850 WP_003901156.1.2086 WP_003901156.1.20868 WP_003901156.1.20876 WP_003901156.1.20897 WP_003901156.1.20898 WP_003901156.1.2090 WP_003901156.1.20911 WP_003901156.1.20916 WP_003901156.1.20921 WP_003901156.1.20926 WP_003901156.1.20927 WP_003901156.1.20951 WP_003901156.1.20970 WP_003901156.1.2104 WP_003901156.1.21070 WP_003901156.1.21127 WP_003901156.1.21135 WP_003901156.1.21173 WP_003901156.1.21187 WP_003901156.1.212 WP_003901156.1.2120 WP_003901156.1.21218 WP_003901156.1.21219 WP_003901156.1.2123 WP_003901156.1.21231 WP_003901156.1.21234 WP_003901156.1.2126 WP_003901156.1.21292 WP_003901156.1.21307 WP_003901156.1.2131 WP_003901156.1.21311 WP_003901156.1.21321 WP_003901156.1.21365 WP_003901156.1.2137 WP_003901156.1.21392 WP_003901156.1.21397 WP_003901156.1.21415 WP_003901156.1.21418 WP_003901156.1.21430 WP_003901156.1.21434 WP_003901156.1.21444 WP_003901156.1.21468 WP_003901156.1.21498 WP_003901156.1.21509 WP_003901156.1.21513 WP_003901156.1.21560 WP_003901156.1.21565 WP_003901156.1.21586 WP_003901156.1.21591 WP_003901156.1.21594 WP_003901156.1.21602 WP_003901156.1.21615 WP_003901156.1.21638 WP_003901156.1.21639 WP_003901156.1.21655 WP_003901156.1.21658 WP_003901156.1.2168 WP_003901156.1.2174 WP_003901156.1.21741 WP_003901156.1.21777 WP_003901156.1.21786 WP_003901156.1.21795 WP_003901156.1.218 WP_003901156.1.21826 WP_003901156.1.21829 WP_003901156.1.21840 WP_003901156.1.21843 WP_003901156.1.21872 WP_003901156.1.21873 WP_003901156.1.2188 WP_003901156.1.21882 WP_003901156.1.21906 WP_003901156.1.21912 WP_003901156.1.2194 WP_003901156.1.21941 WP_003901156.1.21956 WP_003901156.1.21958 WP_003901156.1.21960 WP_003901156.1.21971 WP_003901156.1.21973 WP_003901156.1.21983 WP_003901156.1.22003 WP_003901156.1.22013 WP_003901156.1.22025 WP_003901156.1.22036 WP_003901156.1.22075 WP_003901156.1.22092 WP_003901156.1.2212 WP_003901156.1.22127 WP_003901156.1.22140 WP_003901156.1.22233 WP_003901156.1.22255 WP_003901156.1.22277 WP_003901156.1.22305 WP_003901156.1.22348 WP_003901156.1.22356 WP_003901156.1.22366 WP_003901156.1.2238 WP_003901156.1.22380 WP_003901156.1.22437 WP_003901156.1.22438 WP_003901156.1.22445 WP_003901156.1.22490 WP_003901156.1.22511 WP_003901156.1.22524 WP_003901156.1.2253 WP_003901156.1.22585 WP_003901156.1.22589 WP_003901156.1.22606 WP_003901156.1.22608 WP_003901156.1.22609 WP_003901156.1.22618 WP_003901156.1.2262 WP_003901156.1.22624 WP_003901156.1.22629 WP_003901156.1.22647 WP_003901156.1.22664 WP_003901156.1.22665 WP_003901156.1.22670 WP_003901156.1.22674 WP_003901156.1.22725 WP_003901156.1.22728 WP_003901156.1.22733 WP_003901156.1.22737 WP_003901156.1.2275 WP_003901156.1.22754 WP_003901156.1.22804 WP_003901156.1.22829 WP_003901156.1.22840 WP_003901156.1.22844 WP_003901156.1.22963 WP_003901156.1.22970 WP_003901156.1.22996 WP_003901156.1.22997 WP_003901156.1.22999 WP_003901156.1.23015 WP_003901156.1.23032 WP_003901156.1.231 WP_003901156.1.23101 WP_003901156.1.2312 WP_003901156.1.23140 WP_003901156.1.23153 WP_003901156.1.23171 WP_003901156.1.23199 WP_003901156.1.2320 WP_003901156.1.23204 WP_003901156.1.23216 WP_003901156.1.23229 WP_003901156.1.23233 WP_003901156.1.2326 WP_003901156.1.23261 WP_003901156.1.23272 WP_003901156.1.23289 WP_003901156.1.2329 WP_003901156.1.23308 WP_003901156.1.23316 WP_003901156.1.23321 WP_003901156.1.23325 WP_003901156.1.2339 WP_003901156.1.23406 WP_003901156.1.23438 WP_003901156.1.23445 WP_003901156.1.23447 WP_003901156.1.23452 WP_003901156.1.23461 WP_003901156.1.2349 WP_003901156.1.23496 WP_003901156.1.23506 WP_003901156.1.23530 WP_003901156.1.23539 WP_003901156.1.23546 WP_003901156.1.23551 WP_003901156.1.23573 WP_003901156.1.23583 WP_003901156.1.23588 WP_003901156.1.23628 WP_003901156.1.23677 WP_003901156.1.23692 WP_003901156.1.23694 WP_003901156.1.23699 WP_003901156.1.2371 WP_003901156.1.23803 WP_003901156.1.23807 WP_003901156.1.23825 WP_003901156.1.23832 WP_003901156.1.2384 WP_003901156.1.23843 WP_003901156.1.23863 WP_003901156.1.23894 WP_003901156.1.23993 WP_003901156.1.2400 WP_003901156.1.24007 WP_003901156.1.24008 WP_003901156.1.24046 WP_003901156.1.24057 WP_003901156.1.24062 WP_003901156.1.24113 WP_003901156.1.24119 WP_003901156.1.24128 WP_003901156.1.24140 WP_003901156.1.24176 WP_003901156.1.24190 WP_003901156.1.24202 WP_003901156.1.24261 WP_003901156.1.24284 WP_003901156.1.24294 WP_003901156.1.24357 WP_003901156.1.24396 WP_003901156.1.24414 WP_003901156.1.24423 WP_003901156.1.2443 WP_003901156.1.24446 WP_003901156.1.24461 WP_003901156.1.24500 WP_003901156.1.24507 WP_003901156.1.24509 WP_003901156.1.24529 WP_003901156.1.24553 WP_003901156.1.24599 WP_003901156.1.24629 WP_003901156.1.24638 WP_003901156.1.24648 WP_003901156.1.2466 WP_003901156.1.24824 WP_003901156.1.24831 WP_003901156.1.24840 WP_003901156.1.24848 WP_003901156.1.24857 WP_003901156.1.2487 WP_003901156.1.24893 WP_003901156.1.24907 WP_003901156.1.24933 WP_003901156.1.24958 WP_003901156.1.24985 WP_003901156.1.2499 WP_003901156.1.25004 WP_003901156.1.2505 WP_003901156.1.25051 WP_003901156.1.2507 WP_003901156.1.25096 WP_003901156.1.25103 WP_003901156.1.25129 WP_003901156.1.25171 WP_003901156.1.25184 WP_003901156.1.25247 WP_003901156.1.25252 WP_003901156.1.25278 WP_003901156.1.25309 WP_003901156.1.25313 WP_003901156.1.25338 WP_003901156.1.25342 WP_003901156.1.25343 WP_003901156.1.25367 WP_003901156.1.25393 WP_003901156.1.25406 WP_003901156.1.25435 WP_003901156.1.25437 WP_003901156.1.25445 WP_003901156.1.25455 WP_003901156.1.25473 WP_003901156.1.25504 WP_003901156.1.25513 WP_003901156.1.25542 WP_003901156.1.25579 WP_003901156.1.25594 WP_003901156.1.25606 WP_003901156.1.25645 WP_003901156.1.2566 WP_003901156.1.25673 WP_003901156.1.25674 WP_003901156.1.25693 WP_003901156.1.25699 WP_003901156.1.25727 WP_003901156.1.25736 WP_003901156.1.25738 WP_003901156.1.25756 WP_003901156.1.25759 WP_003901156.1.2580 WP_003901156.1.25813 WP_003901156.1.25853 WP_003901156.1.25854 WP_003901156.1.25874 WP_003901156.1.25885 WP_003901156.1.25892 WP_003901156.1.25914 WP_003901156.1.25916 WP_003901156.1.2594 WP_003901156.1.25954 WP_003901156.1.25972 WP_003901156.1.26017 WP_003901156.1.26032 WP_003901156.1.26038 WP_003901156.1.26072 WP_003901156.1.26089 WP_003901156.1.26097 WP_003901156.1.26098 WP_003901156.1.26108 WP_003901156.1.26109 WP_003901156.1.26118 WP_003901156.1.26126 WP_003901156.1.2614 WP_003901156.1.26168 WP_003901156.1.26182 WP_003901156.1.26190 WP_003901156.1.2620 WP_003901156.1.26234 WP_003901156.1.26243 WP_003901156.1.26265 WP_003901156.1.26267 WP_003901156.1.26292 WP_003901156.1.26310 WP_003901156.1.26328 WP_003901156.1.26349 WP_003901156.1.26366 WP_003901156.1.26374 WP_003901156.1.26407 WP_003901156.1.26412 WP_003901156.1.26454 WP_003901156.1.26464 WP_003901156.1.2653 WP_003901156.1.26560 WP_003901156.1.26571 WP_003901156.1.2659 WP_003901156.1.26597 WP_003901156.1.26603 WP_003901156.1.26629 WP_003901156.1.26651 WP_003901156.1.26702 WP_003901156.1.26707 WP_003901156.1.26710 WP_003901156.1.26719 WP_003901156.1.26737 WP_003901156.1.26738 WP_003901156.1.26745 WP_003901156.1.26756 WP_003901156.1.2676 WP_003901156.1.2677 WP_003901156.1.26779 WP_003901156.1.26780 WP_003901156.1.26798 WP_003901156.1.26854 WP_003901156.1.26868 WP_003901156.1.26876 WP_003901156.1.26888 WP_003901156.1.26914 WP_003901156.1.26945 WP_003901156.1.26959 WP_003901156.1.26969 WP_003901156.1.26984 WP_003901156.1.26992 WP_003901156.1.27004 WP_003901156.1.27017 WP_003901156.1.27045 WP_003901156.1.27074 WP_003901156.1.27075 WP_003901156.1.27128 WP_003901156.1.27130 WP_003901156.1.27139 WP_003901156.1.27152 WP_003901156.1.27162 WP_003901156.1.27164 WP_003901156.1.27193 WP_003901156.1.27235 WP_003901156.1.27254 WP_003901156.1.27278 WP_003901156.1.27343 WP_003901156.1.27352 WP_003901156.1.27369 WP_003901156.1.27391 WP_003901156.1.27398 WP_003901156.1.27410 WP_003901156.1.27411 WP_003901156.1.27449 WP_003901156.1.27460 WP_003901156.1.27463 WP_003901156.1.2749 WP_003901156.1.27492 WP_003901156.1.27528 WP_003901156.1.27541 WP_003901156.1.27576 WP_003901156.1.27582 WP_003901156.1.27596 WP_003901156.1.27607 WP_003901156.1.2766 WP_003901156.1.277 WP_003901156.1.27724 WP_003901156.1.27730 WP_003901156.1.27736 WP_003901156.1.27743 WP_003901156.1.27750 WP_003901156.1.27771 WP_003901156.1.27779 WP_003901156.1.27795 WP_003901156.1.27803 WP_003901156.1.27819 WP_003901156.1.27835 WP_003901156.1.27915 WP_003901156.1.27935 WP_003901156.1.27962 WP_003901156.1.28053 WP_003901156.1.28092 WP_003901156.1.28106 WP_003901156.1.28131 WP_003901156.1.28159 WP_003901156.1.2816 WP_003901156.1.28161 WP_003901156.1.28192 WP_003901156.1.28202 WP_003901156.1.28241 WP_003901156.1.28251 WP_003901156.1.28255 WP_003901156.1.28269 WP_003901156.1.28276 WP_003901156.1.28293 WP_003901156.1.28331 WP_003901156.1.28367 WP_003901156.1.28378 WP_003901156.1.28391 WP_003901156.1.2842 WP_003901156.1.28448 WP_003901156.1.2847 WP_003901156.1.28471 WP_003901156.1.28473 WP_003901156.1.28493 WP_003901156.1.28497 WP_003901156.1.28530 WP_003901156.1.28545 WP_003901156.1.28561 WP_003901156.1.28567 WP_003901156.1.28585 WP_003901156.1.286 WP_003901156.1.28610 WP_003901156.1.28617 WP_003901156.1.28634 WP_003901156.1.28642 WP_003901156.1.28671 WP_003901156.1.28682 WP_003901156.1.28698 WP_003901156.1.28703 WP_003901156.1.28739 WP_003901156.1.28758 WP_003901156.1.28781 WP_003901156.1.28787 WP_003901156.1.28827 WP_003901156.1.28839 WP_003901156.1.28847 WP_003901156.1.28850 WP_003901156.1.28851 WP_003901156.1.28865 WP_003901156.1.28897 WP_003901156.1.28914 WP_003901156.1.28935 WP_003901156.1.28936 WP_003901156.1.28939 WP_003901156.1.28943 WP_003901156.1.28952 WP_003901156.1.28975 WP_003901156.1.2899 WP_003901156.1.28993 WP_003901156.1.29000 WP_003901156.1.2901 WP_003901156.1.29028 WP_003901156.1.29033 WP_003901156.1.29058 WP_003901156.1.29078 WP_003901156.1.29102 WP_003901156.1.29115 WP_003901156.1.2916 WP_003901156.1.29217 WP_003901156.1.29223 WP_003901156.1.29234 WP_003901156.1.29264 WP_003901156.1.29275 WP_003901156.1.29306 WP_003901156.1.29339 WP_003901156.1.29348 WP_003901156.1.29364 WP_003901156.1.29367 WP_003901156.1.2938 WP_003901156.1.29399 WP_003901156.1.29426 WP_003901156.1.2944 WP_003901156.1.29449 WP_003901156.1.29450 WP_003901156.1.29452 WP_003901156.1.2949 WP_003901156.1.29510 WP_003901156.1.29515 WP_003901156.1.29525 WP_003901156.1.2953 WP_003901156.1.29559 WP_003901156.1.29587 WP_003901156.1.2959 WP_003901156.1.29592 WP_003901156.1.29599 WP_003901156.1.29611 WP_003901156.1.29632 WP_003901156.1.29649 WP_003901156.1.2965 WP_003901156.1.29659 WP_003901156.1.2969 WP_003901156.1.29696 WP_003901156.1.29698 WP_003901156.1.29718 WP_003901156.1.29742 WP_003901156.1.29747 WP_003901156.1.29769 WP_003901156.1.29825 WP_003901156.1.29830 WP_003901156.1.29847 WP_003901156.1.29861 WP_003901156.1.29869 WP_003901156.1.29883 WP_003901156.1.29890 WP_003901156.1.299 WP_003901156.1.29931 WP_003901156.1.29960 WP_003901156.1.30014 WP_003901156.1.3004 WP_003901156.1.30040 WP_003901156.1.30043 WP_003901156.1.30074 WP_003901156.1.30097 WP_003901156.1.30101 WP_003901156.1.30106 WP_003901156.1.30114 WP_003901156.1.30126 WP_003901156.1.30131 WP_003901156.1.30138 WP_003901156.1.30139 WP_003901156.1.30145 WP_003901156.1.30224 WP_003901156.1.30235 WP_003901156.1.30237 WP_003901156.1.3027 WP_003901156.1.30279 WP_003901156.1.30282 WP_003901156.1.30283 WP_003901156.1.30288 WP_003901156.1.30291 WP_003901156.1.30363 WP_003901156.1.30374 WP_003901156.1.30404 WP_003901156.1.3043 WP_003901156.1.30433 WP_003901156.1.30438 WP_003901156.1.30462 WP_003901156.1.30464 WP_003901156.1.30468 WP_003901156.1.30500 WP_003901156.1.3057 WP_003901156.1.30574 WP_003901156.1.30628 WP_003901156.1.30641 WP_003901156.1.30642 WP_003901156.1.30661 WP_003901156.1.30669 WP_003901156.1.30683 WP_003901156.1.30699 WP_003901156.1.30709 WP_003901156.1.30713 WP_003901156.1.30716 WP_003901156.1.30730 WP_003901156.1.30732 WP_003901156.1.30736 WP_003901156.1.30745 WP_003901156.1.30760 WP_003901156.1.30791 WP_003901156.1.308 WP_003901156.1.30807 WP_003901156.1.30818 WP_003901156.1.30824 WP_003901156.1.30848 WP_003901156.1.30877 WP_003901156.1.30888 WP_003901156.1.30901 WP_003901156.1.30903 WP_003901156.1.30912 WP_003901156.1.30913 WP_003901156.1.30914 WP_003901156.1.30919 WP_003901156.1.30977 WP_003901156.1.3100 WP_003901156.1.31002 WP_003901156.1.3101 WP_003901156.1.31034 WP_003901156.1.31047 WP_003901156.1.31070 WP_003901156.1.31074 WP_003901156.1.31102 WP_003901156.1.31127 WP_003901156.1.31184 WP_003901156.1.31199 WP_003901156.1.31226 WP_003901156.1.31230 WP_003901156.1.31233 WP_003901156.1.31263 WP_003901156.1.31264 WP_003901156.1.31270 WP_003901156.1.31287 WP_003901156.1.31290 WP_003901156.1.31304 WP_003901156.1.31346 WP_003901156.1.31348 WP_003901156.1.31354 WP_003901156.1.31390 WP_003901156.1.31414 WP_003901156.1.31428 WP_003901156.1.3143 WP_003901156.1.31458 WP_003901156.1.31483 WP_003901156.1.3149 WP_003901156.1.31498 WP_003901156.1.31507 WP_003901156.1.31537 WP_003901156.1.31548 WP_003901156.1.31569 WP_003901156.1.31573 WP_003901156.1.316 WP_003901156.1.31629 WP_003901156.1.31666 WP_003901156.1.31693 WP_003901156.1.31703 WP_003901156.1.31744 WP_003901156.1.31745 WP_003901156.1.31770 WP_003901156.1.31776 WP_003901156.1.31783 WP_003901156.1.318 WP_003901156.1.3184 WP_003901156.1.31840 WP_003901156.1.31880 WP_003901156.1.31911 WP_003901156.1.31930 WP_003901156.1.31932 WP_003901156.1.31955 WP_003901156.1.31985 WP_003901156.1.31991 WP_003901156.1.31995 WP_003901156.1.32004 WP_003901156.1.32039 WP_003901156.1.3204 WP_003901156.1.32045 WP_003901156.1.32071 WP_003901156.1.32098 WP_003901156.1.32132 WP_003901156.1.32157 WP_003901156.1.32164 WP_003901156.1.32179 WP_003901156.1.32198 WP_003901156.1.32297 WP_003901156.1.32317 WP_003901156.1.32383 WP_003901156.1.32403 WP_003901156.1.32416 WP_003901156.1.32421 WP_003901156.1.32433 WP_003901156.1.32461 WP_003901156.1.32482 WP_003901156.1.32503 WP_003901156.1.32556 WP_003901156.1.32562 WP_003901156.1.32569 WP_003901156.1.32592 WP_003901156.1.32620 WP_003901156.1.32647 WP_003901156.1.32654 WP_003901156.1.3268 WP_003901156.1.32695 WP_003901156.1.32706 WP_003901156.1.32716 WP_003901156.1.32738 WP_003901156.1.32752 WP_003901156.1.32780 WP_003901156.1.32781 WP_003901156.1.32793 WP_003901156.1.32799 WP_003901156.1.32822 WP_003901156.1.32833 WP_003901156.1.32862 WP_003901156.1.32880 WP_003901156.1.32897 WP_003901156.1.32909 WP_003901156.1.32935 WP_003901156.1.32974 WP_003901156.1.33007 WP_003901156.1.3302 WP_003901156.1.33028 WP_003901156.1.33035 WP_003901156.1.33044 WP_003901156.1.33054 WP_003901156.1.33082 WP_003901156.1.33141 WP_003901156.1.33148 WP_003901156.1.33155 WP_003901156.1.33168 WP_003901156.1.3321 WP_003901156.1.33215 WP_003901156.1.3325 WP_003901156.1.3327 WP_003901156.1.33278 WP_003901156.1.33288 WP_003901156.1.33305 WP_003901156.1.3331 WP_003901156.1.33319 WP_003901156.1.3333 WP_003901156.1.33393 WP_003901156.1.33403 WP_003901156.1.33452 WP_003901156.1.33467 WP_003901156.1.33477 WP_003901156.1.3349 WP_003901156.1.33519 WP_003901156.1.33542 WP_003901156.1.33601 WP_003901156.1.33602 WP_003901156.1.33633 WP_003901156.1.33646 WP_003901156.1.33673 WP_003901156.1.3369 WP_003901156.1.33705 WP_003901156.1.33762 WP_003901156.1.33783 WP_003901156.1.33789 WP_003901156.1.3383 WP_003901156.1.33832 WP_003901156.1.33839 WP_003901156.1.33848 WP_003901156.1.3387 WP_003901156.1.33886 WP_003901156.1.33895 WP_003901156.1.33906 WP_003901156.1.33912 WP_003901156.1.33954 WP_003901156.1.3399 WP_003901156.1.34042 WP_003901156.1.3405 WP_003901156.1.34055 WP_003901156.1.34056 WP_003901156.1.34065 WP_003901156.1.3408 WP_003901156.1.34090 WP_003901156.1.34109 WP_003901156.1.34111 WP_003901156.1.34131 WP_003901156.1.34152 WP_003901156.1.34153 WP_003901156.1.34163 WP_003901156.1.34181 WP_003901156.1.34197 WP_003901156.1.34198 WP_003901156.1.34215 WP_003901156.1.34219 WP_003901156.1.34255 WP_003901156.1.34260 WP_003901156.1.34275 WP_003901156.1.343 WP_003901156.1.34347 WP_003901156.1.34358 WP_003901156.1.34392 WP_003901156.1.344 WP_003901156.1.34428 WP_003901156.1.3443 WP_003901156.1.34435 WP_003901156.1.34446 WP_003901156.1.34499 WP_003901156.1.34505 WP_003901156.1.34516 WP_003901156.1.34529 WP_003901156.1.34551 WP_003901156.1.34563 WP_003901156.1.34576 WP_003901156.1.34581 WP_003901156.1.34588 WP_003901156.1.34596 WP_003901156.1.34599 WP_003901156.1.34639 WP_003901156.1.34724 WP_003901156.1.34740 WP_003901156.1.34755 WP_003901156.1.34777 WP_003901156.1.34783 WP_003901156.1.34841 WP_003901156.1.34908 WP_003901156.1.34919 WP_003901156.1.3492 WP_003901156.1.34933 WP_003901156.1.34945 WP_003901156.1.34946 WP_003901156.1.34960 WP_003901156.1.34961 WP_003901156.1.34963 WP_003901156.1.34965 WP_003901156.1.34968 WP_003901156.1.35023 WP_003901156.1.35069 WP_003901156.1.35072 WP_003901156.1.35078 WP_003901156.1.35146 WP_003901156.1.35156 WP_003901156.1.35160 WP_003901156.1.35162 WP_003901156.1.35176 WP_003901156.1.3520 WP_003901156.1.35213 WP_003901156.1.35221 WP_003901156.1.35246 WP_003901156.1.35278 WP_003901156.1.35301 WP_003901156.1.35311 WP_003901156.1.35317 WP_003901156.1.35319 WP_003901156.1.35347 WP_003901156.1.35363 WP_003901156.1.35382 WP_003901156.1.35385 WP_003901156.1.35396 WP_003901156.1.35397 WP_003901156.1.35426 WP_003901156.1.35439 WP_003901156.1.35455 WP_003901156.1.3548 WP_003901156.1.35484 WP_003901156.1.35492 WP_003901156.1.3553 WP_003901156.1.35553 WP_003901156.1.35555 WP_003901156.1.35561 WP_003901156.1.35602 WP_003901156.1.35610 WP_003901156.1.35635 WP_003901156.1.35657 WP_003901156.1.35687 WP_003901156.1.35689 WP_003901156.1.35707 WP_003901156.1.35732 WP_003901156.1.35754 WP_003901156.1.35767 WP_003901156.1.35770 WP_003901156.1.35771 WP_003901156.1.35780 WP_003901156.1.35805 WP_003901156.1.35811 WP_003901156.1.35821 WP_003901156.1.3584 WP_003901156.1.35848 WP_003901156.1.35864 WP_003901156.1.35874 WP_003901156.1.35876 WP_003901156.1.35897 WP_003901156.1.35899 WP_003901156.1.35923 WP_003901156.1.3593 WP_003901156.1.35954 WP_003901156.1.36005 WP_003901156.1.36014 WP_003901156.1.36023 WP_003901156.1.36051 WP_003901156.1.36053 WP_003901156.1.36075 WP_003901156.1.36089 WP_003901156.1.36097 WP_003901156.1.36098 WP_003901156.1.36116 WP_003901156.1.36145 WP_003901156.1.36156 WP_003901156.1.36205 WP_003901156.1.36228 WP_003901156.1.36246 WP_003901156.1.36252 WP_003901156.1.36260 WP_003901156.1.36270 WP_003901156.1.36271 WP_003901156.1.36303 WP_003901156.1.36309 WP_003901156.1.36315 WP_003901156.1.36319 WP_003901156.1.36321 WP_003901156.1.36326 WP_003901156.1.3634 WP_003901156.1.36356 WP_003901156.1.36357 WP_003901156.1.3636 WP_003901156.1.36385 WP_003901156.1.36399 WP_003901156.1.36436 WP_003901156.1.36465 WP_003901156.1.36469 WP_003901156.1.36473 WP_003901156.1.36485 WP_003901156.1.36508 WP_003901156.1.36540 WP_003901156.1.36561 WP_003901156.1.36571 WP_003901156.1.36573 WP_003901156.1.36578 WP_003901156.1.36585 WP_003901156.1.36597 WP_003901156.1.36614 WP_003901156.1.36657 WP_003901156.1.36674 WP_003901156.1.36720 WP_003901156.1.36727 WP_003901156.1.36733 WP_003901156.1.36810 WP_003901156.1.36844 WP_003901156.1.36851 WP_003901156.1.36862 WP_003901156.1.36893 WP_003901156.1.36901 WP_003901156.1.36921 WP_003901156.1.36935 WP_003901156.1.36941 WP_003901156.1.3695 WP_003901156.1.36951 WP_003901156.1.36968 WP_003901156.1.3700 WP_003901156.1.37004 WP_003901156.1.37012 WP_003901156.1.37071 WP_003901156.1.37088 WP_003901156.1.37157 WP_003901156.1.37175 WP_003901156.1.37188 WP_003901156.1.37213 WP_003901156.1.37229 WP_003901156.1.3724 WP_003901156.1.37277 WP_003901156.1.37305 WP_003901156.1.37330 WP_003901156.1.37389 WP_003901156.1.37440 WP_003901156.1.37459 WP_003901156.1.37468 WP_003901156.1.37475 WP_003901156.1.37484 WP_003901156.1.37601 WP_003901156.1.37612 WP_003901156.1.37632 WP_003901156.1.37643 WP_003901156.1.37655 WP_003901156.1.37660 WP_003901156.1.37674 WP_003901156.1.37700 WP_003901156.1.37701 WP_003901156.1.37709 WP_003901156.1.37711 WP_003901156.1.37721 WP_003901156.1.37722 WP_003901156.1.37747 WP_003901156.1.37765 WP_003901156.1.37772 WP_003901156.1.37804 WP_003901156.1.37809 WP_003901156.1.37859 WP_003901156.1.37877 WP_003901156.1.37912 WP_003901156.1.37913 WP_003901156.1.37943 WP_003901156.1.37950 WP_003901156.1.37973 WP_003901156.1.37975 WP_003901156.1.37983 WP_003901156.1.38 WP_003901156.1.38002 WP_003901156.1.3802 WP_003901156.1.38039 WP_003901156.1.38040 WP_003901156.1.38068 WP_003901156.1.38135 WP_003901156.1.38138 WP_003901156.1.38144 WP_003901156.1.38158 WP_003901156.1.38159 WP_003901156.1.38210 WP_003901156.1.38233 WP_003901156.1.38240 WP_003901156.1.38299 WP_003901156.1.38332 WP_003901156.1.38347 WP_003901156.1.38354 WP_003901156.1.38380 WP_003901156.1.38384 WP_003901156.1.38389 WP_003901156.1.38398 WP_003901156.1.38402 WP_003901156.1.38418 WP_003901156.1.38421 WP_003901156.1.38466 WP_003901156.1.38477 WP_003901156.1.38483 WP_003901156.1.3849 WP_003901156.1.385 WP_003901156.1.38530 WP_003901156.1.38535 WP_003901156.1.38539 WP_003901156.1.38594 WP_003901156.1.38601 WP_003901156.1.38611 WP_003901156.1.38638 WP_003901156.1.38639 WP_003901156.1.38646 WP_003901156.1.38648 WP_003901156.1.38654 WP_003901156.1.38659 WP_003901156.1.38660 WP_003901156.1.38666 WP_003901156.1.38671 WP_003901156.1.38672 WP_003901156.1.38750 WP_003901156.1.38772 WP_003901156.1.38812 WP_003901156.1.38821 WP_003901156.1.38844 WP_003901156.1.38863 WP_003901156.1.38865 WP_003901156.1.38873 WP_003901156.1.3889 WP_003901156.1.38894 WP_003901156.1.38909 WP_003901156.1.38939 WP_003901156.1.38974 WP_003901156.1.38975 WP_003901156.1.38991 WP_003901156.1.39025 WP_003901156.1.39070 WP_003901156.1.39072 WP_003901156.1.39095 WP_003901156.1.39106 WP_003901156.1.39165 WP_003901156.1.39174 WP_003901156.1.39176 WP_003901156.1.39178 WP_003901156.1.39190 WP_003901156.1.39201 WP_003901156.1.39207 WP_003901156.1.39211 WP_003901156.1.39236 WP_003901156.1.39239 WP_003901156.1.39252 WP_003901156.1.39288 WP_003901156.1.39295 WP_003901156.1.39306 WP_003901156.1.39359 WP_003901156.1.39364 WP_003901156.1.39400 WP_003901156.1.39447 WP_003901156.1.3945 WP_003901156.1.39450 WP_003901156.1.39455 WP_003901156.1.39521 WP_003901156.1.39560 WP_003901156.1.39592 WP_003901156.1.39593 WP_003901156.1.396 WP_003901156.1.3960 WP_003901156.1.39616 WP_003901156.1.39654 WP_003901156.1.39661 WP_003901156.1.39674 WP_003901156.1.39678 WP_003901156.1.3968 WP_003901156.1.39694 WP_003901156.1.3971 WP_003901156.1.39718 WP_003901156.1.39728 WP_003901156.1.39739 WP_003901156.1.39748 WP_003901156.1.39751 WP_003901156.1.39759 WP_003901156.1.39801 WP_003901156.1.39804 WP_003901156.1.39848 WP_003901156.1.39877 WP_003901156.1.39925 WP_003901156.1.3994 WP_003901156.1.39959 WP_003901156.1.3996 WP_003901156.1.39960 WP_003901156.1.3997 WP_003901156.1.39980 WP_003901156.1.40000 WP_003901156.1.40028 WP_003901156.1.40029 WP_003901156.1.4003 WP_003901156.1.40094 WP_003901156.1.40096 WP_003901156.1.40150 WP_003901156.1.40156 WP_003901156.1.40174 WP_003901156.1.40186 WP_003901156.1.40276 WP_003901156.1.40277 WP_003901156.1.40323 WP_003901156.1.40336 WP_003901156.1.40353 WP_003901156.1.4036 WP_003901156.1.40372 WP_003901156.1.40402 WP_003901156.1.40413 WP_003901156.1.40440 WP_003901156.1.40446 WP_003901156.1.40451 WP_003901156.1.40455 WP_003901156.1.40523 WP_003901156.1.40641 WP_003901156.1.40646 WP_003901156.1.40651 WP_003901156.1.40653 WP_003901156.1.4067 WP_003901156.1.40705 WP_003901156.1.40723 WP_003901156.1.40731 WP_003901156.1.40735 WP_003901156.1.40795 WP_003901156.1.40799 WP_003901156.1.40852 WP_003901156.1.40876 WP_003901156.1.40881 WP_003901156.1.40922 WP_003901156.1.40948 WP_003901156.1.4095 WP_003901156.1.40956 WP_003901156.1.40957 WP_003901156.1.40964 WP_003901156.1.4097 WP_003901156.1.410 WP_003901156.1.41000 WP_003901156.1.41055 WP_003901156.1.41108 WP_003901156.1.41123 WP_003901156.1.41177 WP_003901156.1.41202 WP_003901156.1.41219 WP_003901156.1.41231 WP_003901156.1.41249 WP_003901156.1.4127 WP_003901156.1.41296 WP_003901156.1.41355 WP_003901156.1.41376 WP_003901156.1.41430 WP_003901156.1.41447 WP_003901156.1.41469 WP_003901156.1.41504 WP_003901156.1.41553 WP_003901156.1.41564 WP_003901156.1.41583 WP_003901156.1.41616 WP_003901156.1.41632 WP_003901156.1.41635 WP_003901156.1.41648 WP_003901156.1.41660 WP_003901156.1.41685 WP_003901156.1.41695 WP_003901156.1.41704 WP_003901156.1.4171 WP_003901156.1.41719 WP_003901156.1.41733 WP_003901156.1.41744 WP_003901156.1.41774 WP_003901156.1.41791 WP_003901156.1.41803 WP_003901156.1.41820 WP_003901156.1.41828 WP_003901156.1.41829 WP_003901156.1.41860 WP_003901156.1.41912 WP_003901156.1.41921 WP_003901156.1.41933 WP_003901156.1.41944 WP_003901156.1.42043 WP_003901156.1.42075 WP_003901156.1.42078 WP_003901156.1.42094 WP_003901156.1.42112 WP_003901156.1.4212 WP_003901156.1.42122 WP_003901156.1.42134 WP_003901156.1.42183 WP_003901156.1.42188 WP_003901156.1.42201 WP_003901156.1.42202 WP_003901156.1.42208 WP_003901156.1.42247 WP_003901156.1.42255 WP_003901156.1.42273 WP_003901156.1.42278 WP_003901156.1.42304 WP_003901156.1.42309 WP_003901156.1.42370 WP_003901156.1.42385 WP_003901156.1.42400 WP_003901156.1.42414 WP_003901156.1.42417 WP_003901156.1.42430 WP_003901156.1.42461 WP_003901156.1.42465 WP_003901156.1.42467 WP_003901156.1.42473 WP_003901156.1.42474 WP_003901156.1.4248 WP_003901156.1.42494 WP_003901156.1.42519 WP_003901156.1.42524 WP_003901156.1.42534 WP_003901156.1.4255 WP_003901156.1.42562 WP_003901156.1.42568 WP_003901156.1.42570 WP_003901156.1.42618 WP_003901156.1.42660 WP_003901156.1.42695 WP_003901156.1.42704 WP_003901156.1.42705 WP_003901156.1.42722 WP_003901156.1.42777 WP_003901156.1.42782 WP_003901156.1.42835 WP_003901156.1.42839 WP_003901156.1.42842 WP_003901156.1.42905 WP_003901156.1.42916 WP_003901156.1.42930 WP_003901156.1.42971 WP_003901156.1.43005 WP_003901156.1.43009 WP_003901156.1.43053 WP_003901156.1.43082 WP_003901156.1.43087 WP_003901156.1.43098 WP_003901156.1.43208 WP_003901156.1.43236 WP_003901156.1.43246 WP_003901156.1.43255 WP_003901156.1.43266 WP_003901156.1.43273 WP_003901156.1.43296 WP_003901156.1.43306 WP_003901156.1.4335 WP_003901156.1.43368 WP_003901156.1.43395 WP_003901156.1.43457 WP_003901156.1.43462 WP_003901156.1.43475 WP_003901156.1.43478 WP_003901156.1.43484 WP_003901156.1.43557 WP_003901156.1.43578 WP_003901156.1.43588 WP_003901156.1.43643 WP_003901156.1.43664 WP_003901156.1.43684 WP_003901156.1.43686 WP_003901156.1.43706 WP_003901156.1.43716 WP_003901156.1.4377 WP_003901156.1.43781 WP_003901156.1.43794 WP_003901156.1.43815 WP_003901156.1.43846 WP_003901156.1.43861 WP_003901156.1.43863 WP_003901156.1.43866 WP_003901156.1.43872 WP_003901156.1.43885 WP_003901156.1.43897 WP_003901156.1.4390 WP_003901156.1.43902 WP_003901156.1.43921 WP_003901156.1.43936 WP_003901156.1.43937 WP_003901156.1.43960 WP_003901156.1.43965 WP_003901156.1.4399 WP_003901156.1.43993 WP_003901156.1.43996 WP_003901156.1.44 WP_003901156.1.44001 WP_003901156.1.44008 WP_003901156.1.44016 WP_003901156.1.44033 WP_003901156.1.44037 WP_003901156.1.44041 WP_003901156.1.44070 WP_003901156.1.44071 WP_003901156.1.44076 WP_003901156.1.44104 WP_003901156.1.44111 WP_003901156.1.44124 WP_003901156.1.44169 WP_003901156.1.44219 WP_003901156.1.44237 WP_003901156.1.44277 WP_003901156.1.44279 WP_003901156.1.44336 WP_003901156.1.44355 WP_003901156.1.44358 WP_003901156.1.4438 WP_003901156.1.44390 WP_003901156.1.44392 WP_003901156.1.4441 WP_003901156.1.44415 WP_003901156.1.44464 WP_003901156.1.44466 WP_003901156.1.44489 WP_003901156.1.44492 WP_003901156.1.44494 WP_003901156.1.44500 WP_003901156.1.44526 WP_003901156.1.44532 WP_003901156.1.44534 WP_003901156.1.44562 WP_003901156.1.44589 WP_003901156.1.44597 WP_003901156.1.44600 WP_003901156.1.44602 WP_003901156.1.44615 WP_003901156.1.4464 WP_003901156.1.44651 WP_003901156.1.44659 WP_003901156.1.44665 WP_003901156.1.44694 WP_003901156.1.44700 WP_003901156.1.44735 WP_003901156.1.44740 WP_003901156.1.44757 WP_003901156.1.4476 WP_003901156.1.44761 WP_003901156.1.44767 WP_003901156.1.44776 WP_003901156.1.44779 WP_003901156.1.44786 WP_003901156.1.44808 WP_003901156.1.44864 WP_003901156.1.44901 WP_003901156.1.44908 WP_003901156.1.44913 WP_003901156.1.4492 WP_003901156.1.44939 WP_003901156.1.44979 WP_003901156.1.44981 WP_003901156.1.45002 WP_003901156.1.45011 WP_003901156.1.4504 WP_003901156.1.45062 WP_003901156.1.45066 WP_003901156.1.45081 WP_003901156.1.45113 WP_003901156.1.45129 WP_003901156.1.45135 WP_003901156.1.45147 WP_003901156.1.45168 WP_003901156.1.4517 WP_003901156.1.45181 WP_003901156.1.45185 WP_003901156.1.45192 WP_003901156.1.45200 WP_003901156.1.45205 WP_003901156.1.45211 WP_003901156.1.45249 WP_003901156.1.4526 WP_003901156.1.45286 WP_003901156.1.45326 WP_003901156.1.45347 WP_003901156.1.45374 WP_003901156.1.45390 WP_003901156.1.454 WP_003901156.1.45407 WP_003901156.1.45451 WP_003901156.1.45453 WP_003901156.1.45460 WP_003901156.1.45463 WP_003901156.1.45470 WP_003901156.1.45474 WP_003901156.1.45491 WP_003901156.1.45510 WP_003901156.1.45563 WP_003901156.1.45584 WP_003901156.1.45590 WP_003901156.1.45619 WP_003901156.1.45626 WP_003901156.1.45631 WP_003901156.1.45666 WP_003901156.1.45697 WP_003901156.1.4571 WP_003901156.1.45731 WP_003901156.1.45743 WP_003901156.1.45765 WP_003901156.1.45776 WP_003901156.1.45783 WP_003901156.1.45805 WP_003901156.1.45815 WP_003901156.1.45849 WP_003901156.1.45867 WP_003901156.1.45884 WP_003901156.1.4590 WP_003901156.1.45923 WP_003901156.1.45926 WP_003901156.1.45963 WP_003901156.1.45992 WP_003901156.1.46025 WP_003901156.1.46083 WP_003901156.1.46090 WP_003901156.1.46092 WP_003901156.1.46100 WP_003901156.1.46101 WP_003901156.1.46103 WP_003901156.1.46107 WP_003901156.1.46127 WP_003901156.1.46128 WP_003901156.1.46141 WP_003901156.1.46150 WP_003901156.1.46201 WP_003901156.1.46226 WP_003901156.1.4624 WP_003901156.1.46253 WP_003901156.1.46268 WP_003901156.1.46285 WP_003901156.1.46300 WP_003901156.1.46313 WP_003901156.1.46336 WP_003901156.1.46365 WP_003901156.1.46370 WP_003901156.1.46381 WP_003901156.1.46402 WP_003901156.1.46411 WP_003901156.1.4644 WP_003901156.1.46442 WP_003901156.1.46453 WP_003901156.1.46463 WP_003901156.1.46478 WP_003901156.1.46492 WP_003901156.1.46521 WP_003901156.1.4653 WP_003901156.1.46532 WP_003901156.1.46539 WP_003901156.1.46568 WP_003901156.1.46585 WP_003901156.1.46609 WP_003901156.1.46613 WP_003901156.1.46625 WP_003901156.1.46642 WP_003901156.1.46647 WP_003901156.1.46674 WP_003901156.1.46724 WP_003901156.1.46758 WP_003901156.1.46773 WP_003901156.1.46777 WP_003901156.1.46786 WP_003901156.1.46792 WP_003901156.1.46847 WP_003901156.1.46851 WP_003901156.1.4687 WP_003901156.1.46897 WP_003901156.1.46936 WP_003901156.1.46980 WP_003901156.1.47011 WP_003901156.1.47012 WP_003901156.1.47066 WP_003901156.1.47077 WP_003901156.1.47083 WP_003901156.1.47106 WP_003901156.1.47147 WP_003901156.1.47166 WP_003901156.1.47178 WP_003901156.1.47179 WP_003901156.1.47194 WP_003901156.1.47207 WP_003901156.1.47210 WP_003901156.1.47261 WP_003901156.1.47262 WP_003901156.1.47402 WP_003901156.1.47423 WP_003901156.1.47467 WP_003901156.1.47502 WP_003901156.1.4751 WP_003901156.1.47511 WP_003901156.1.47537 WP_003901156.1.47540 WP_003901156.1.47568 WP_003901156.1.47572 WP_003901156.1.47588 WP_003901156.1.47636 WP_003901156.1.4764 WP_003901156.1.47653 WP_003901156.1.47679 WP_003901156.1.47690 WP_003901156.1.4771 WP_003901156.1.47717 WP_003901156.1.47743 WP_003901156.1.47754 WP_003901156.1.47773 WP_003901156.1.47776 WP_003901156.1.47780 WP_003901156.1.47805 WP_003901156.1.47832 WP_003901156.1.47847 WP_003901156.1.47858 WP_003901156.1.47861 WP_003901156.1.47868 WP_003901156.1.47893 WP_003901156.1.47899 WP_003901156.1.479 WP_003901156.1.47912 WP_003901156.1.47913 WP_003901156.1.47926 WP_003901156.1.4794 WP_003901156.1.47943 WP_003901156.1.47944 WP_003901156.1.47959 WP_003901156.1.47974 WP_003901156.1.47993 WP_003901156.1.48004 WP_003901156.1.48039 WP_003901156.1.48050 WP_003901156.1.48084 WP_003901156.1.48097 WP_003901156.1.48101 WP_003901156.1.4813 WP_003901156.1.48130 WP_003901156.1.48143 WP_003901156.1.48152 WP_003901156.1.48155 WP_003901156.1.48170 WP_003901156.1.48173 WP_003901156.1.48177 WP_003901156.1.48185 WP_003901156.1.48204 WP_003901156.1.48219 WP_003901156.1.4823 WP_003901156.1.48240 WP_003901156.1.48256 WP_003901156.1.48264 WP_003901156.1.48287 WP_003901156.1.48330 WP_003901156.1.48333 WP_003901156.1.48348 WP_003901156.1.48354 WP_003901156.1.48372 WP_003901156.1.48383 WP_003901156.1.48419 WP_003901156.1.48423 WP_003901156.1.48443 WP_003901156.1.48450 WP_003901156.1.48462 WP_003901156.1.48543 WP_003901156.1.48550 WP_003901156.1.48605 WP_003901156.1.48618 WP_003901156.1.4863 WP_003901156.1.48648 WP_003901156.1.48658 WP_003901156.1.48666 WP_003901156.1.48687 WP_003901156.1.48779 WP_003901156.1.4878 WP_003901156.1.48798 WP_003901156.1.48826 WP_003901156.1.48831 WP_003901156.1.48843 WP_003901156.1.48857 WP_003901156.1.4890 WP_003901156.1.48946 WP_003901156.1.48979 WP_003901156.1.49017 WP_003901156.1.49048 WP_003901156.1.49059 WP_003901156.1.4906 WP_003901156.1.4907 WP_003901156.1.49103 WP_003901156.1.49110 WP_003901156.1.49111 WP_003901156.1.49112 WP_003901156.1.4919 WP_003901156.1.49251 WP_003901156.1.49254 WP_003901156.1.49263 WP_003901156.1.49291 WP_003901156.1.49296 WP_003901156.1.49335 WP_003901156.1.49337 WP_003901156.1.49419 WP_003901156.1.49426 WP_003901156.1.49437 WP_003901156.1.49439 WP_003901156.1.49474 WP_003901156.1.49506 WP_003901156.1.49516 WP_003901156.1.49523 WP_003901156.1.49526 WP_003901156.1.49532 WP_003901156.1.49588 WP_003901156.1.4959 WP_003901156.1.49678 WP_003901156.1.49687 WP_003901156.1.49699 WP_003901156.1.49709 WP_003901156.1.4971 WP_003901156.1.4972 WP_003901156.1.49736 WP_003901156.1.49746 WP_003901156.1.49764 WP_003901156.1.49773 WP_003901156.1.49796 WP_003901156.1.49814 WP_003901156.1.49815 WP_003901156.1.49816 WP_003901156.1.49839 WP_003901156.1.49857 WP_003901156.1.49878 WP_003901156.1.49880 WP_003901156.1.49944 WP_003901156.1.4999 WP_003901156.1.49990 WP_003901156.1.50068 WP_003901156.1.50077 WP_003901156.1.5008 WP_003901156.1.50081 WP_003901156.1.50122 WP_003901156.1.50126 WP_003901156.1.50149 WP_003901156.1.50162 WP_003901156.1.5018 WP_003901156.1.50194 WP_003901156.1.50218 WP_003901156.1.50235 WP_003901156.1.50249 WP_003901156.1.50265 WP_003901156.1.50271 WP_003901156.1.50324 WP_003901156.1.50347 WP_003901156.1.50372 WP_003901156.1.50398 WP_003901156.1.50407 WP_003901156.1.50444 WP_003901156.1.50466 WP_003901156.1.50472 WP_003901156.1.5048 WP_003901156.1.50498 WP_003901156.1.5050 WP_003901156.1.50540 WP_003901156.1.50554 WP_003901156.1.50557 WP_003901156.1.50610 WP_003901156.1.50632 WP_003901156.1.50633 WP_003901156.1.50642 WP_003901156.1.50655 WP_003901156.1.50659 WP_003901156.1.50683 WP_003901156.1.50689 WP_003901156.1.50692 WP_003901156.1.50714 WP_003901156.1.50729 WP_003901156.1.50756 WP_003901156.1.50784 WP_003901156.1.50794 WP_003901156.1.50841 WP_003901156.1.50860 WP_003901156.1.50868 WP_003901156.1.50877 WP_003901156.1.5096 WP_003901156.1.50981 WP_003901156.1.50987 WP_003901156.1.51003 WP_003901156.1.51009 WP_003901156.1.51037 WP_003901156.1.51074 WP_003901156.1.51082 WP_003901156.1.51101 WP_003901156.1.51116 WP_003901156.1.51149 WP_003901156.1.51156 WP_003901156.1.51157 WP_003901156.1.51213 WP_003901156.1.51232 WP_003901156.1.51239 WP_003901156.1.51247 WP_003901156.1.51279 WP_003901156.1.51291 WP_003901156.1.51294 WP_003901156.1.51301 WP_003901156.1.51329 WP_003901156.1.51391 WP_003901156.1.51422 WP_003901156.1.51445 WP_003901156.1.51455 WP_003901156.1.51466 WP_003901156.1.51468 WP_003901156.1.51478 WP_003901156.1.51497 WP_003901156.1.51520 WP_003901156.1.51628 WP_003901156.1.5164 WP_003901156.1.51647 WP_003901156.1.51660 WP_003901156.1.51696 WP_003901156.1.51721 WP_003901156.1.51788 WP_003901156.1.51795 WP_003901156.1.51801 WP_003901156.1.51817 WP_003901156.1.51819 WP_003901156.1.51854 WP_003901156.1.51923 WP_003901156.1.51942 WP_003901156.1.51948 WP_003901156.1.51963 WP_003901156.1.51969 WP_003901156.1.52000 WP_003901156.1.52001 WP_003901156.1.52003 WP_003901156.1.52006 WP_003901156.1.52036 WP_003901156.1.52038 WP_003901156.1.52046 WP_003901156.1.52059 WP_003901156.1.52069 WP_003901156.1.52082 WP_003901156.1.52102 WP_003901156.1.52166 WP_003901156.1.52168 WP_003901156.1.52173 WP_003901156.1.52178 WP_003901156.1.52206 WP_003901156.1.52216 WP_003901156.1.52238 WP_003901156.1.52241 WP_003901156.1.52280 WP_003901156.1.52314 WP_003901156.1.52385 WP_003901156.1.52390 WP_003901156.1.524 WP_003901156.1.52460 WP_003901156.1.52485 WP_003901156.1.52486 WP_003901156.1.52495 WP_003901156.1.52504 WP_003901156.1.52522 WP_003901156.1.52531 WP_003901156.1.52533 WP_003901156.1.52545 WP_003901156.1.52553 WP_003901156.1.52563 WP_003901156.1.52564 WP_003901156.1.52574 WP_003901156.1.52673 WP_003901156.1.52674 WP_003901156.1.52708 WP_003901156.1.52713 WP_003901156.1.52761 WP_003901156.1.52778 WP_003901156.1.52791 WP_003901156.1.52797 WP_003901156.1.52818 WP_003901156.1.52872 WP_003901156.1.52873 WP_003901156.1.52891 WP_003901156.1.52892 WP_003901156.1.52909 WP_003901156.1.52970 WP_003901156.1.52998 WP_003901156.1.53053 WP_003901156.1.53056 WP_003901156.1.5306 WP_003901156.1.53088 WP_003901156.1.5309 WP_003901156.1.531 WP_003901156.1.53117 WP_003901156.1.53118 WP_003901156.1.53142 WP_003901156.1.53143 WP_003901156.1.53157 WP_003901156.1.53167 WP_003901156.1.53200 WP_003901156.1.53204 WP_003901156.1.53213 WP_003901156.1.53217 WP_003901156.1.53226 WP_003901156.1.53229 WP_003901156.1.53230 WP_003901156.1.53237 WP_003901156.1.53254 WP_003901156.1.53257 WP_003901156.1.5327 WP_003901156.1.53276 WP_003901156.1.53278 WP_003901156.1.533 WP_003901156.1.53302 WP_003901156.1.53306 WP_003901156.1.5334 WP_003901156.1.5335 WP_003901156.1.53353 WP_003901156.1.53381 WP_003901156.1.53413 WP_003901156.1.53458 WP_003901156.1.53460 WP_003901156.1.53480 WP_003901156.1.53517 WP_003901156.1.53522 WP_003901156.1.53525 WP_003901156.1.53526 WP_003901156.1.53553 WP_003901156.1.53606 WP_003901156.1.53628 WP_003901156.1.53643 WP_003901156.1.53667 WP_003901156.1.53679 WP_003901156.1.53715 WP_003901156.1.53730 WP_003901156.1.53742 WP_003901156.1.53743 WP_003901156.1.53754 WP_003901156.1.53775 WP_003901156.1.53787 WP_003901156.1.53803 WP_003901156.1.53818 WP_003901156.1.53822 WP_003901156.1.53853 WP_003901156.1.53865 WP_003901156.1.53888 WP_003901156.1.53900 WP_003901156.1.53912 WP_003901156.1.53914 WP_003901156.1.53952 WP_003901156.1.5398 WP_003901156.1.5408 WP_003901156.1.54089 WP_003901156.1.54093 WP_003901156.1.54099 WP_003901156.1.54112 WP_003901156.1.54125 WP_003901156.1.54141 WP_003901156.1.54162 WP_003901156.1.54179 WP_003901156.1.54206 WP_003901156.1.54218 WP_003901156.1.54225 WP_003901156.1.54227 WP_003901156.1.54232 WP_003901156.1.54241 WP_003901156.1.54245 WP_003901156.1.54247 WP_003901156.1.54260 WP_003901156.1.54275 WP_003901156.1.54280 WP_003901156.1.5429 WP_003901156.1.54294 WP_003901156.1.54314 WP_003901156.1.54347 WP_003901156.1.54351 WP_003901156.1.54370 WP_003901156.1.54428 WP_003901156.1.54449 WP_003901156.1.54494 WP_003901156.1.54502 WP_003901156.1.54514 WP_003901156.1.54519 WP_003901156.1.5452 WP_003901156.1.54531 WP_003901156.1.54537 WP_003901156.1.54553 WP_003901156.1.54555 WP_003901156.1.54575 WP_003901156.1.54633 WP_003901156.1.54686 WP_003901156.1.54687 WP_003901156.1.54705 WP_003901156.1.54730 WP_003901156.1.54732 WP_003901156.1.5475 WP_003901156.1.54797 WP_003901156.1.54807 WP_003901156.1.54836 WP_003901156.1.54838 WP_003901156.1.54860 WP_003901156.1.54888 WP_003901156.1.54905 WP_003901156.1.54909 WP_003901156.1.54937 WP_003901156.1.54939 WP_003901156.1.54944 WP_003901156.1.54945 WP_003901156.1.54953 WP_003901156.1.54964 WP_003901156.1.55015 WP_003901156.1.55022 WP_003901156.1.55023 WP_003901156.1.55051 WP_003901156.1.55088 WP_003901156.1.55106 WP_003901156.1.55126 WP_003901156.1.55128 WP_003901156.1.55140 WP_003901156.1.55150 WP_003901156.1.55210 WP_003901156.1.55227 WP_003901156.1.55248 WP_003901156.1.55257 WP_003901156.1.55258 WP_003901156.1.55267 WP_003901156.1.55279 WP_003901156.1.55307 WP_003901156.1.55326 WP_003901156.1.55328 WP_003901156.1.5533 WP_003901156.1.55345 WP_003901156.1.55396 WP_003901156.1.55398 WP_003901156.1.55441 WP_003901156.1.55459 WP_003901156.1.55501 WP_003901156.1.55504 WP_003901156.1.55578 WP_003901156.1.55626 WP_003901156.1.55641 WP_003901156.1.5569 WP_003901156.1.55723 WP_003901156.1.55735 WP_003901156.1.5574 WP_003901156.1.55772 WP_003901156.1.55802 WP_003901156.1.55807 WP_003901156.1.55819 WP_003901156.1.55821 WP_003901156.1.5583 WP_003901156.1.55849 WP_003901156.1.55856 WP_003901156.1.55860 WP_003901156.1.55882 WP_003901156.1.55883 WP_003901156.1.55894 WP_003901156.1.55902 WP_003901156.1.55908 WP_003901156.1.55909 WP_003901156.1.5591 WP_003901156.1.55961 WP_003901156.1.55977 WP_003901156.1.56028 WP_003901156.1.56057 WP_003901156.1.56060 WP_003901156.1.56107 WP_003901156.1.56132 WP_003901156.1.56163 WP_003901156.1.56167 WP_003901156.1.56178 WP_003901156.1.56287 WP_003901156.1.56292 WP_003901156.1.56327 WP_003901156.1.56341 WP_003901156.1.56359 WP_003901156.1.56365 WP_003901156.1.56394 WP_003901156.1.56443 WP_003901156.1.56473 WP_003901156.1.56478 WP_003901156.1.56500 WP_003901156.1.56517 WP_003901156.1.56534 WP_003901156.1.5656 WP_003901156.1.56577 WP_003901156.1.56593 WP_003901156.1.56625 WP_003901156.1.56637 WP_003901156.1.56670 WP_003901156.1.56697 WP_003901156.1.567 WP_003901156.1.56701 WP_003901156.1.56709 WP_003901156.1.56729 WP_003901156.1.56743 WP_003901156.1.56755 WP_003901156.1.56764 WP_003901156.1.56769 WP_003901156.1.56770 WP_003901156.1.56795 WP_003901156.1.5681 WP_003901156.1.56827 WP_003901156.1.56839 WP_003901156.1.56863 WP_003901156.1.56868 WP_003901156.1.56869 WP_003901156.1.56915 WP_003901156.1.56926 WP_003901156.1.56961 WP_003901156.1.56971 WP_003901156.1.56972 WP_003901156.1.57023 WP_003901156.1.57035 WP_003901156.1.57077 WP_003901156.1.57087 WP_003901156.1.57094 WP_003901156.1.57134 WP_003901156.1.57151 WP_003901156.1.57169 WP_003901156.1.57208 WP_003901156.1.57212 WP_003901156.1.57230 WP_003901156.1.5724 WP_003901156.1.5725 WP_003901156.1.5727 WP_003901156.1.57273 WP_003901156.1.573 WP_003901156.1.57314 WP_003901156.1.57326 WP_003901156.1.57328 WP_003901156.1.57331 WP_003901156.1.57340 WP_003901156.1.57351 WP_003901156.1.57352 WP_003901156.1.57380 WP_003901156.1.57430 WP_003901156.1.5744 WP_003901156.1.57440 WP_003901156.1.5745 WP_003901156.1.57461 WP_003901156.1.57469 WP_003901156.1.57489 WP_003901156.1.575 WP_003901156.1.57509 WP_003901156.1.57519 WP_003901156.1.57525 WP_003901156.1.57551 WP_003901156.1.5758 WP_003901156.1.57596 WP_003901156.1.57604 WP_003901156.1.57616 WP_003901156.1.57617 WP_003901156.1.57619 WP_003901156.1.57627 WP_003901156.1.57642 WP_003901156.1.57658 WP_003901156.1.57667 WP_003901156.1.57675 WP_003901156.1.57689 WP_003901156.1.57708 WP_003901156.1.57794 WP_003901156.1.57821 WP_003901156.1.57825 WP_003901156.1.57843 WP_003901156.1.57906 WP_003901156.1.57924 WP_003901156.1.57926 WP_003901156.1.57930 WP_003901156.1.57957 WP_003901156.1.57960 WP_003901156.1.57964 WP_003901156.1.57991 WP_003901156.1.58000 WP_003901156.1.58086 WP_003901156.1.58101 WP_003901156.1.58103 WP_003901156.1.58108 WP_003901156.1.5811 WP_003901156.1.58121 WP_003901156.1.58145 WP_003901156.1.58164 WP_003901156.1.58174 WP_003901156.1.582 WP_003901156.1.58202 WP_003901156.1.58209 WP_003901156.1.58215 WP_003901156.1.5824 WP_003901156.1.58250 WP_003901156.1.58259 WP_003901156.1.58283 WP_003901156.1.5830 WP_003901156.1.58303 WP_003901156.1.58311 WP_003901156.1.58330 WP_003901156.1.58359 WP_003901156.1.58386 WP_003901156.1.58393 WP_003901156.1.58431 WP_003901156.1.5844 WP_003901156.1.58457 WP_003901156.1.58488 WP_003901156.1.58518 WP_003901156.1.58534 WP_003901156.1.58559 WP_003901156.1.58567 WP_003901156.1.58573 WP_003901156.1.58602 WP_003901156.1.58612 WP_003901156.1.58619 WP_003901156.1.58630 WP_003901156.1.5865 WP_003901156.1.58671 WP_003901156.1.58690 WP_003901156.1.58702 WP_003901156.1.58743 WP_003901156.1.58754 WP_003901156.1.5879 WP_003901156.1.5881 WP_003901156.1.58848 WP_003901156.1.58857 WP_003901156.1.58891 WP_003901156.1.58892 WP_003901156.1.5890 WP_003901156.1.58904 WP_003901156.1.58921 WP_003901156.1.58930 WP_003901156.1.58939 WP_003901156.1.58941 WP_003901156.1.58961 WP_003901156.1.5898 WP_003901156.1.59025 WP_003901156.1.59029 WP_003901156.1.59037 WP_003901156.1.59044 WP_003901156.1.59085 WP_003901156.1.59088 WP_003901156.1.59112 WP_003901156.1.59130 WP_003901156.1.5914 WP_003901156.1.59147 WP_003901156.1.59166 WP_003901156.1.59205 WP_003901156.1.59209 WP_003901156.1.59237 WP_003901156.1.59240 WP_003901156.1.59253 WP_003901156.1.59254 WP_003901156.1.59262 WP_003901156.1.59270 WP_003901156.1.5928 WP_003901156.1.59304 WP_003901156.1.59305 WP_003901156.1.59309 WP_003901156.1.59316 WP_003901156.1.59326 WP_003901156.1.59328 WP_003901156.1.59333 WP_003901156.1.59338 WP_003901156.1.59428 WP_003901156.1.59487 WP_003901156.1.59537 WP_003901156.1.59561 WP_003901156.1.59677 WP_003901156.1.59722 WP_003901156.1.59727 WP_003901156.1.59732 WP_003901156.1.59738 WP_003901156.1.59750 WP_003901156.1.59757 WP_003901156.1.59761 WP_003901156.1.59808 WP_003901156.1.59850 WP_003901156.1.59856 WP_003901156.1.59860 WP_003901156.1.59861 WP_003901156.1.5987 WP_003901156.1.59878 WP_003901156.1.59888 WP_003901156.1.59952 WP_003901156.1.5996 WP_003901156.1.59961 WP_003901156.1.59974 WP_003901156.1.6000 WP_003901156.1.60007 WP_003901156.1.60016 WP_003901156.1.6003 WP_003901156.1.60047 WP_003901156.1.6007 WP_003901156.1.60121 WP_003901156.1.60125 WP_003901156.1.60135 WP_003901156.1.60139 WP_003901156.1.60152 WP_003901156.1.60171 WP_003901156.1.60197 WP_003901156.1.6020 WP_003901156.1.60205 WP_003901156.1.60207 WP_003901156.1.60215 WP_003901156.1.60217 WP_003901156.1.60267 WP_003901156.1.60288 WP_003901156.1.60291 WP_003901156.1.60301 WP_003901156.1.60305 WP_003901156.1.60312 WP_003901156.1.60313 WP_003901156.1.60314 WP_003901156.1.60367 WP_003901156.1.60376 WP_003901156.1.60403 WP_003901156.1.60413 WP_003901156.1.60421 WP_003901156.1.60451 WP_003901156.1.60460 WP_003901156.1.60479 WP_003901156.1.60487 WP_003901156.1.60512 WP_003901156.1.60573 WP_003901156.1.60583 WP_003901156.1.60632 WP_003901156.1.60657 WP_003901156.1.60687 WP_003901156.1.60689 WP_003901156.1.60727 WP_003901156.1.60738 WP_003901156.1.60763 WP_003901156.1.6077 WP_003901156.1.60791 WP_003901156.1.60834 WP_003901156.1.60870 WP_003901156.1.60878 WP_003901156.1.60879 WP_003901156.1.60913 WP_003901156.1.60978 WP_003901156.1.61000 WP_003901156.1.61001 WP_003901156.1.61012 WP_003901156.1.61014 WP_003901156.1.61015 WP_003901156.1.61037 WP_003901156.1.61052 WP_003901156.1.61065 WP_003901156.1.61100 WP_003901156.1.61101 WP_003901156.1.61138 WP_003901156.1.61142 WP_003901156.1.61198 WP_003901156.1.612 WP_003901156.1.61234 WP_003901156.1.61256 WP_003901156.1.61281 WP_003901156.1.61314 WP_003901156.1.61321 WP_003901156.1.61326 WP_003901156.1.61328 WP_003901156.1.61368 WP_003901156.1.61391 WP_003901156.1.61406 WP_003901156.1.61409 WP_003901156.1.61420 WP_003901156.1.61422 WP_003901156.1.61425 WP_003901156.1.61428 WP_003901156.1.61469 WP_003901156.1.61494 WP_003901156.1.61522 WP_003901156.1.61552 WP_003901156.1.61557 WP_003901156.1.61567 WP_003901156.1.61571 WP_003901156.1.61573 WP_003901156.1.61584 WP_003901156.1.61586 WP_003901156.1.6159 WP_003901156.1.6160 WP_003901156.1.61614 WP_003901156.1.6163 WP_003901156.1.61655 WP_003901156.1.61665 WP_003901156.1.61669 WP_003901156.1.61682 WP_003901156.1.61692 WP_003901156.1.61719 WP_003901156.1.61728 WP_003901156.1.61750 WP_003901156.1.61754 WP_003901156.1.61755 WP_003901156.1.61757 WP_003901156.1.61778 WP_003901156.1.6179 WP_003901156.1.61842 WP_003901156.1.61850 WP_003901156.1.61862 WP_003901156.1.61865 WP_003901156.1.61868 WP_003901156.1.61911 WP_003901156.1.61941 WP_003901156.1.61953 WP_003901156.1.61979 WP_003901156.1.61986 WP_003901156.1.61987 WP_003901156.1.62021 WP_003901156.1.62087 WP_003901156.1.62089 WP_003901156.1.62101 WP_003901156.1.62104 WP_003901156.1.6211 WP_003901156.1.62132 WP_003901156.1.62162 WP_003901156.1.62225 WP_003901156.1.62230 WP_003901156.1.62238 WP_003901156.1.62249 WP_003901156.1.62270 WP_003901156.1.62281 WP_003901156.1.62307 WP_003901156.1.6231 WP_003901156.1.62359 WP_003901156.1.62360 WP_003901156.1.62371 WP_003901156.1.62379 WP_003901156.1.62395 WP_003901156.1.62408 WP_003901156.1.62449 WP_003901156.1.62468 WP_003901156.1.6248 WP_003901156.1.62508 WP_003901156.1.62565 WP_003901156.1.62594 WP_003901156.1.62606 WP_003901156.1.62616 WP_003901156.1.62666 WP_003901156.1.62687 WP_003901156.1.62715 WP_003901156.1.62730 WP_003901156.1.62738 WP_003901156.1.62761 WP_003901156.1.62766 WP_003901156.1.62786 WP_003901156.1.62813 WP_003901156.1.62839 WP_003901156.1.62841 WP_003901156.1.62909 WP_003901156.1.62936 WP_003901156.1.6294 WP_003901156.1.6295 WP_003901156.1.62962 WP_003901156.1.63007 WP_003901156.1.63019 WP_003901156.1.63032 WP_003901156.1.63037 WP_003901156.1.63064 WP_003901156.1.63066 WP_003901156.1.63072 WP_003901156.1.6308 WP_003901156.1.63081 WP_003901156.1.63096 WP_003901156.1.63106 WP_003901156.1.6314 WP_003901156.1.63144 WP_003901156.1.63154 WP_003901156.1.63160 WP_003901156.1.63161 WP_003901156.1.63166 WP_003901156.1.63175 WP_003901156.1.63194 WP_003901156.1.6322 WP_003901156.1.63222 WP_003901156.1.63247 WP_003901156.1.6328 WP_003901156.1.63291 WP_003901156.1.63312 WP_003901156.1.63317 WP_003901156.1.63331 WP_003901156.1.63373 WP_003901156.1.63384 WP_003901156.1.63403 WP_003901156.1.63424 WP_003901156.1.63428 WP_003901156.1.6345 WP_003901156.1.63464 WP_003901156.1.63483 WP_003901156.1.63502 WP_003901156.1.63504 WP_003901156.1.63522 WP_003901156.1.63530 WP_003901156.1.63564 WP_003901156.1.63567 WP_003901156.1.63596 WP_003901156.1.63600 WP_003901156.1.63623 WP_003901156.1.63624 WP_003901156.1.63625 WP_003901156.1.63627 WP_003901156.1.63654 WP_003901156.1.63662 WP_003901156.1.63711 WP_003901156.1.63734 WP_003901156.1.63807 WP_003901156.1.63819 WP_003901156.1.63844 WP_003901156.1.63888 WP_003901156.1.63913 WP_003901156.1.63918 WP_003901156.1.63961 WP_003901156.1.63970 WP_003901156.1.64027 WP_003901156.1.64058 WP_003901156.1.64065 WP_003901156.1.6407 WP_003901156.1.64082 WP_003901156.1.64091 WP_003901156.1.64102 WP_003901156.1.64104 WP_003901156.1.64119 WP_003901156.1.64169 WP_003901156.1.64219 WP_003901156.1.6422 WP_003901156.1.64222 WP_003901156.1.64223 WP_003901156.1.64228 WP_003901156.1.64235 WP_003901156.1.6427 WP_003901156.1.64278 WP_003901156.1.64287 WP_003901156.1.64414 WP_003901156.1.64419 WP_003901156.1.6443 WP_003901156.1.64463 WP_003901156.1.64480 WP_003901156.1.64497 WP_003901156.1.64506 WP_003901156.1.64511 WP_003901156.1.64513 WP_003901156.1.64514 WP_003901156.1.64515 WP_003901156.1.64522 WP_003901156.1.64526 WP_003901156.1.64543 WP_003901156.1.6456 WP_003901156.1.64567 WP_003901156.1.64588 WP_003901156.1.64589 WP_003901156.1.64594 WP_003901156.1.64595 WP_003901156.1.64608 WP_003901156.1.64619 WP_003901156.1.64629 WP_003901156.1.6464 WP_003901156.1.64664 WP_003901156.1.64669 WP_003901156.1.64672 WP_003901156.1.64680 WP_003901156.1.64682 WP_003901156.1.64727 WP_003901156.1.64729 WP_003901156.1.64774 WP_003901156.1.64776 WP_003901156.1.64802 WP_003901156.1.64832 WP_003901156.1.6486 WP_003901156.1.64870 WP_003901156.1.64898 WP_003901156.1.64922 WP_003901156.1.64924 WP_003901156.1.6493 WP_003901156.1.64941 WP_003901156.1.64966 WP_003901156.1.64973 WP_003901156.1.65001 WP_003901156.1.65026 WP_003901156.1.65053 WP_003901156.1.65070 WP_003901156.1.65079 WP_003901156.1.65102 WP_003901156.1.65157 WP_003901156.1.65181 WP_003901156.1.65212 WP_003901156.1.65229 WP_003901156.1.6523 WP_003901156.1.65253 WP_003901156.1.65289 WP_003901156.1.65291 WP_003901156.1.65315 WP_003901156.1.65329 WP_003901156.1.65359 WP_003901156.1.6536 WP_003901156.1.65374 WP_003901156.1.65414 WP_003901156.1.65416 WP_003901156.1.65433 WP_003901156.1.65455 WP_003901156.1.65467 WP_003901156.1.65488 WP_003901156.1.65529 WP_003901156.1.65539 WP_003901156.1.65583 WP_003901156.1.65612 WP_003901156.1.65623 WP_003901156.1.65635 WP_003901156.1.65637 WP_003901156.1.65648 WP_003901156.1.65683 WP_003901156.1.65686 WP_003901156.1.65688 WP_003901156.1.65707 WP_003901156.1.65733 WP_003901156.1.65746 WP_003901156.1.65747 WP_003901156.1.65759 WP_003901156.1.65816 WP_003901156.1.65830 WP_003901156.1.65858 WP_003901156.1.65862 WP_003901156.1.65869 WP_003901156.1.65893 WP_003901156.1.65929 WP_003901156.1.65932 WP_003901156.1.65958 WP_003901156.1.65974 WP_003901156.1.66004 WP_003901156.1.66013 WP_003901156.1.6606 WP_003901156.1.66089 WP_003901156.1.66151 WP_003901156.1.66229 WP_003901156.1.66276 WP_003901156.1.66293 WP_003901156.1.66297 WP_003901156.1.66323 WP_003901156.1.66325 WP_003901156.1.6633 WP_003901156.1.66334 WP_003901156.1.66355 WP_003901156.1.66367 WP_003901156.1.66394 WP_003901156.1.66396 WP_003901156.1.66451 WP_003901156.1.66455 WP_003901156.1.66457 WP_003901156.1.66460 WP_003901156.1.66464 WP_003901156.1.66466 WP_003901156.1.66487 WP_003901156.1.66504 WP_003901156.1.66544 WP_003901156.1.66558 WP_003901156.1.66580 WP_003901156.1.66582 WP_003901156.1.66612 WP_003901156.1.66615 WP_003901156.1.66617 WP_003901156.1.66635 WP_003901156.1.66656 WP_003901156.1.66663 WP_003901156.1.66675 WP_003901156.1.66715 WP_003901156.1.66718 WP_003901156.1.66762 WP_003901156.1.66776 WP_003901156.1.66808 WP_003901156.1.66817 WP_003901156.1.66819 WP_003901156.1.66826 WP_003901156.1.66830 WP_003901156.1.66842 WP_003901156.1.66868 WP_003901156.1.66878 WP_003901156.1.66880 WP_003901156.1.66893 WP_003901156.1.66961 WP_003901156.1.67005 WP_003901156.1.6704 WP_003901156.1.67044 WP_003901156.1.67061 WP_003901156.1.67089 WP_003901156.1.67098 WP_003901156.1.67146 WP_003901156.1.67170 WP_003901156.1.67197 WP_003901156.1.67198 WP_003901156.1.6720 WP_003901156.1.67207 WP_003901156.1.67218 WP_003901156.1.67220 WP_003901156.1.67225 WP_003901156.1.67231 WP_003901156.1.6724 WP_003901156.1.67257 WP_003901156.1.67298 WP_003901156.1.67324 WP_003901156.1.67332 WP_003901156.1.67346 WP_003901156.1.67354 WP_003901156.1.67360 WP_003901156.1.67381 WP_003901156.1.67396 WP_003901156.1.67417 WP_003901156.1.67422 WP_003901156.1.67453 WP_003901156.1.67459 WP_003901156.1.67473 WP_003901156.1.67481 WP_003901156.1.67482 WP_003901156.1.67496 WP_003901156.1.67499 WP_003901156.1.67516 WP_003901156.1.67523 WP_003901156.1.67536 WP_003901156.1.67575 WP_003901156.1.67587 WP_003901156.1.67598 WP_003901156.1.67600 WP_003901156.1.67602 WP_003901156.1.67630 WP_003901156.1.67679 WP_003901156.1.67692 WP_003901156.1.67744 WP_003901156.1.6775 WP_003901156.1.67750 WP_003901156.1.6777 WP_003901156.1.67809 WP_003901156.1.67816 WP_003901156.1.67844 WP_003901156.1.67848 WP_003901156.1.67870 WP_003901156.1.67888 WP_003901156.1.67915 WP_003901156.1.67945 WP_003901156.1.67949 WP_003901156.1.67980 WP_003901156.1.67982 WP_003901156.1.68022 WP_003901156.1.68029 WP_003901156.1.68037 WP_003901156.1.68038 WP_003901156.1.68045 WP_003901156.1.68057 WP_003901156.1.68083 WP_003901156.1.68088 WP_003901156.1.68106 WP_003901156.1.68110 WP_003901156.1.68153 WP_003901156.1.68164 WP_003901156.1.68169 WP_003901156.1.68193 WP_003901156.1.68212 WP_003901156.1.68227 WP_003901156.1.68243 WP_003901156.1.6825 WP_003901156.1.68297 WP_003901156.1.68309 WP_003901156.1.68325 WP_003901156.1.68329 WP_003901156.1.68340 WP_003901156.1.68384 WP_003901156.1.68388 WP_003901156.1.68429 WP_003901156.1.6843 WP_003901156.1.68433 WP_003901156.1.68444 WP_003901156.1.68465 WP_003901156.1.68484 WP_003901156.1.68518 WP_003901156.1.68569 WP_003901156.1.68576 WP_003901156.1.68580 WP_003901156.1.68586 WP_003901156.1.68623 WP_003901156.1.68624 WP_003901156.1.68637 WP_003901156.1.68646 WP_003901156.1.68667 WP_003901156.1.68669 WP_003901156.1.68672 WP_003901156.1.68684 WP_003901156.1.68704 WP_003901156.1.68708 WP_003901156.1.6872 WP_003901156.1.68730 WP_003901156.1.68734 WP_003901156.1.68754 WP_003901156.1.6876 WP_003901156.1.68761 WP_003901156.1.68763 WP_003901156.1.68766 WP_003901156.1.68774 WP_003901156.1.68796 WP_003901156.1.68824 WP_003901156.1.68832 WP_003901156.1.68833 WP_003901156.1.68841 WP_003901156.1.68859 WP_003901156.1.68876 WP_003901156.1.68916 WP_003901156.1.68923 WP_003901156.1.68945 WP_003901156.1.6896 WP_003901156.1.68981 WP_003901156.1.68984 WP_003901156.1.68997 WP_003901156.1.69008 WP_003901156.1.69076 WP_003901156.1.69079 WP_003901156.1.6908 WP_003901156.1.69082 WP_003901156.1.69178 WP_003901156.1.69181 WP_003901156.1.69208 WP_003901156.1.69231 WP_003901156.1.69256 WP_003901156.1.69311 WP_003901156.1.69315 WP_003901156.1.69322 WP_003901156.1.69342 WP_003901156.1.6935 WP_003901156.1.6936 WP_003901156.1.69369 WP_003901156.1.69374 WP_003901156.1.69398 WP_003901156.1.69401 WP_003901156.1.69426 WP_003901156.1.69427 WP_003901156.1.69429 WP_003901156.1.6949 WP_003901156.1.6951 WP_003901156.1.69511 WP_003901156.1.69526 WP_003901156.1.69528 WP_003901156.1.69547 WP_003901156.1.69573 WP_003901156.1.69581 WP_003901156.1.6960 WP_003901156.1.69617 WP_003901156.1.69634 WP_003901156.1.69647 WP_003901156.1.69659 WP_003901156.1.69673 WP_003901156.1.69682 WP_003901156.1.69684 WP_003901156.1.69686 WP_003901156.1.69707 WP_003901156.1.69709 WP_003901156.1.69723 WP_003901156.1.69736 WP_003901156.1.69778 WP_003901156.1.69800 WP_003901156.1.69802 WP_003901156.1.69845 WP_003901156.1.69870 WP_003901156.1.69873 WP_003901156.1.69898 WP_003901156.1.69913 WP_003901156.1.69925 WP_003901156.1.69931 WP_003901156.1.69938 WP_003901156.1.69955 WP_003901156.1.69957 WP_003901156.1.69981 WP_003901156.1.69990 WP_003901156.1.70 WP_003901156.1.70000 WP_003901156.1.70017 WP_003901156.1.70032 WP_003901156.1.70055 WP_003901156.1.70062 WP_003901156.1.70072 WP_003901156.1.70131 WP_003901156.1.70132 WP_003901156.1.7022 WP_003901156.1.70227 WP_003901156.1.70255 WP_003901156.1.70271 WP_003901156.1.70274 WP_003901156.1.7029 WP_003901156.1.70325 WP_003901156.1.70328 WP_003901156.1.70356 WP_003901156.1.70364 WP_003901156.1.70368 WP_003901156.1.70369 WP_003901156.1.70418 WP_003901156.1.70422 WP_003901156.1.70435 WP_003901156.1.70444 WP_003901156.1.70463 WP_003901156.1.70471 WP_003901156.1.70480 WP_003901156.1.70494 WP_003901156.1.70498 WP_003901156.1.70505 WP_003901156.1.70525 WP_003901156.1.70573 WP_003901156.1.70577 WP_003901156.1.70610 WP_003901156.1.70615 WP_003901156.1.70618 WP_003901156.1.70622 WP_003901156.1.70626 WP_003901156.1.70668 WP_003901156.1.70699 WP_003901156.1.70704 WP_003901156.1.70729 WP_003901156.1.70757 WP_003901156.1.70782 WP_003901156.1.70830 WP_003901156.1.70834 WP_003901156.1.7084 WP_003901156.1.70840 WP_003901156.1.70864 WP_003901156.1.70871 WP_003901156.1.70915 WP_003901156.1.70955 WP_003901156.1.70958 WP_003901156.1.70964 WP_003901156.1.70976 WP_003901156.1.71015 WP_003901156.1.71026 WP_003901156.1.71063 WP_003901156.1.71076 WP_003901156.1.71083 WP_003901156.1.7111 WP_003901156.1.71118 WP_003901156.1.7113 WP_003901156.1.71187 WP_003901156.1.71191 WP_003901156.1.71255 WP_003901156.1.71258 WP_003901156.1.71259 WP_003901156.1.71289 WP_003901156.1.71326 WP_003901156.1.71329 WP_003901156.1.71331 WP_003901156.1.71344 WP_003901156.1.71390 WP_003901156.1.71399 WP_003901156.1.71414 WP_003901156.1.71440 WP_003901156.1.71457 WP_003901156.1.71464 WP_003901156.1.71490 WP_003901156.1.71492 WP_003901156.1.71509 WP_003901156.1.71516 WP_003901156.1.71517 WP_003901156.1.71527 WP_003901156.1.71532 WP_003901156.1.71545 WP_003901156.1.71546 WP_003901156.1.71569 WP_003901156.1.71604 WP_003901156.1.71621 WP_003901156.1.71638 WP_003901156.1.71654 WP_003901156.1.71664 WP_003901156.1.71665 WP_003901156.1.71683 WP_003901156.1.71701 WP_003901156.1.71718 WP_003901156.1.71731 WP_003901156.1.71778 WP_003901156.1.71781 WP_003901156.1.71803 WP_003901156.1.71820 WP_003901156.1.71847 WP_003901156.1.7185 WP_003901156.1.71851 WP_003901156.1.71871 WP_003901156.1.71909 WP_003901156.1.71957 WP_003901156.1.71970 WP_003901156.1.72047 WP_003901156.1.72061 WP_003901156.1.72062 WP_003901156.1.72072 WP_003901156.1.72111 WP_003901156.1.72122 WP_003901156.1.72128 WP_003901156.1.72143 WP_003901156.1.7216 WP_003901156.1.72168 WP_003901156.1.72179 WP_003901156.1.72209 WP_003901156.1.72218 WP_003901156.1.72227 WP_003901156.1.7224 WP_003901156.1.72268 WP_003901156.1.72332 WP_003901156.1.72380 WP_003901156.1.72401 WP_003901156.1.72405 WP_003901156.1.72420 WP_003901156.1.72441 WP_003901156.1.72451 WP_003901156.1.72452 WP_003901156.1.72457 WP_003901156.1.72459 WP_003901156.1.72460 WP_003901156.1.72466 WP_003901156.1.72487 WP_003901156.1.72488 WP_003901156.1.72492 WP_003901156.1.72506 WP_003901156.1.72543 WP_003901156.1.7256 WP_003901156.1.72576 WP_003901156.1.72578 WP_003901156.1.72585 WP_003901156.1.72591 WP_003901156.1.72592 WP_003901156.1.72640 WP_003901156.1.7266 WP_003901156.1.72661 WP_003901156.1.72684 WP_003901156.1.72739 WP_003901156.1.72744 WP_003901156.1.72755 WP_003901156.1.72759 WP_003901156.1.72784 WP_003901156.1.72792 WP_003901156.1.72826 WP_003901156.1.72831 WP_003901156.1.72852 WP_003901156.1.72853 WP_003901156.1.72879 WP_003901156.1.72880 WP_003901156.1.72938 WP_003901156.1.72954 WP_003901156.1.72957 WP_003901156.1.72959 WP_003901156.1.72973 WP_003901156.1.7298 WP_003901156.1.72982 WP_003901156.1.72988 WP_003901156.1.72993 WP_003901156.1.73006 WP_003901156.1.73013 WP_003901156.1.73025 WP_003901156.1.73028 WP_003901156.1.73042 WP_003901156.1.73045 WP_003901156.1.73092 WP_003901156.1.73118 WP_003901156.1.7312 WP_003901156.1.73127 WP_003901156.1.73134 WP_003901156.1.73150 WP_003901156.1.73154 WP_003901156.1.73163 WP_003901156.1.73182 WP_003901156.1.73205 WP_003901156.1.7321 WP_003901156.1.73310 WP_003901156.1.73365 WP_003901156.1.73391 WP_003901156.1.73404 WP_003901156.1.73424 WP_003901156.1.73436 WP_003901156.1.73445 WP_003901156.1.73453 WP_003901156.1.73465 WP_003901156.1.73466 WP_003901156.1.73470 WP_003901156.1.73471 WP_003901156.1.73478 WP_003901156.1.73482 WP_003901156.1.73507 WP_003901156.1.73532 WP_003901156.1.73550 WP_003901156.1.73564 WP_003901156.1.73623 WP_003901156.1.73629 WP_003901156.1.73644 WP_003901156.1.7366 WP_003901156.1.73661 WP_003901156.1.7368 WP_003901156.1.73688 WP_003901156.1.73723 WP_003901156.1.73744 WP_003901156.1.73750 WP_003901156.1.73760 WP_003901156.1.73774 WP_003901156.1.7379 WP_003901156.1.73813 WP_003901156.1.73840 WP_003901156.1.73876 WP_003901156.1.73986 WP_003901156.1.74016 WP_003901156.1.74039 WP_003901156.1.74083 WP_003901156.1.74101 WP_003901156.1.74107 WP_003901156.1.74120 WP_003901156.1.74129 WP_003901156.1.74144 WP_003901156.1.7417 WP_003901156.1.74190 WP_003901156.1.74210 WP_003901156.1.7423 WP_003901156.1.74259 WP_003901156.1.74262 WP_003901156.1.74269 WP_003901156.1.74282 WP_003901156.1.74291 WP_003901156.1.74296 WP_003901156.1.74304 WP_003901156.1.7432 WP_003901156.1.74347 WP_003901156.1.7436 WP_003901156.1.74378 WP_003901156.1.74382 WP_003901156.1.74395 WP_003901156.1.74400 WP_003901156.1.74401 WP_003901156.1.74432 WP_003901156.1.74442 WP_003901156.1.74477 WP_003901156.1.74487 WP_003901156.1.74499 WP_003901156.1.74504 WP_003901156.1.74511 WP_003901156.1.74523 WP_003901156.1.74525 WP_003901156.1.74551 WP_003901156.1.74555 WP_003901156.1.74628 WP_003901156.1.74641 WP_003901156.1.74653 WP_003901156.1.74660 WP_003901156.1.74683 WP_003901156.1.7469 WP_003901156.1.74725 WP_003901156.1.74760 WP_003901156.1.74786 WP_003901156.1.74809 WP_003901156.1.74820 WP_003901156.1.74870 WP_003901156.1.74881 WP_003901156.1.74888 WP_003901156.1.74952 WP_003901156.1.7496 WP_003901156.1.74988 WP_003901156.1.75055 WP_003901156.1.75078 WP_003901156.1.75081 WP_003901156.1.75120 WP_003901156.1.75163 WP_003901156.1.75188 WP_003901156.1.75200 WP_003901156.1.75202 WP_003901156.1.75234 WP_003901156.1.75239 WP_003901156.1.75250 WP_003901156.1.75263 WP_003901156.1.75281 WP_003901156.1.75342 WP_003901156.1.7535 WP_003901156.1.75376 WP_003901156.1.75391 WP_003901156.1.75395 WP_003901156.1.75441 WP_003901156.1.75510 WP_003901156.1.75581 WP_003901156.1.75598 WP_003901156.1.75635 WP_003901156.1.75645 WP_003901156.1.75665 WP_003901156.1.75671 WP_003901156.1.75741 WP_003901156.1.75749 WP_003901156.1.75772 WP_003901156.1.75774 WP_003901156.1.75811 WP_003901156.1.75833 WP_003901156.1.7585 WP_003901156.1.75864 WP_003901156.1.75868 WP_003901156.1.75878 WP_003901156.1.75927 WP_003901156.1.75946 WP_003901156.1.75968 WP_003901156.1.75974 WP_003901156.1.76007 WP_003901156.1.76016 WP_003901156.1.76032 WP_003901156.1.76037 WP_003901156.1.7604 WP_003901156.1.76045 WP_003901156.1.76052 WP_003901156.1.76058 WP_003901156.1.76064 WP_003901156.1.76110 WP_003901156.1.76126 WP_003901156.1.76133 WP_003901156.1.76138 WP_003901156.1.76157 WP_003901156.1.76172 WP_003901156.1.76177 WP_003901156.1.76183 WP_003901156.1.76209 WP_003901156.1.76239 WP_003901156.1.76272 WP_003901156.1.76277 WP_003901156.1.76280 WP_003901156.1.76281 WP_003901156.1.76291 WP_003901156.1.76297 WP_003901156.1.76360 WP_003901156.1.76379 WP_003901156.1.76403 WP_003901156.1.76413 WP_003901156.1.76414 WP_003901156.1.76427 WP_003901156.1.76436 WP_003901156.1.76442 WP_003901156.1.76443 WP_003901156.1.76456 WP_003901156.1.76521 WP_003901156.1.76533 WP_003901156.1.76616 WP_003901156.1.76625 WP_003901156.1.76629 WP_003901156.1.76635 WP_003901156.1.76638 WP_003901156.1.76639 WP_003901156.1.76640 WP_003901156.1.76644 WP_003901156.1.76677 WP_003901156.1.76678 WP_003901156.1.76734 WP_003901156.1.76744 WP_003901156.1.76750 WP_003901156.1.76754 WP_003901156.1.76757 WP_003901156.1.76781 WP_003901156.1.76818 WP_003901156.1.76824 WP_003901156.1.76835 WP_003901156.1.76873 WP_003901156.1.76881 WP_003901156.1.76888 WP_003901156.1.76900 WP_003901156.1.7691 WP_003901156.1.76947 WP_003901156.1.76954 WP_003901156.1.76955 WP_003901156.1.76963 WP_003901156.1.76976 WP_003901156.1.770 WP_003901156.1.77000 WP_003901156.1.77008 WP_003901156.1.77021 WP_003901156.1.77056 WP_003901156.1.77065 WP_003901156.1.77075 WP_003901156.1.77093 WP_003901156.1.77107 WP_003901156.1.77115 WP_003901156.1.77118 WP_003901156.1.77125 WP_003901156.1.77141 WP_003901156.1.77142 WP_003901156.1.77166 WP_003901156.1.77250 WP_003901156.1.77252 WP_003901156.1.77260 WP_003901156.1.77266 WP_003901156.1.77280 WP_003901156.1.77285 WP_003901156.1.77312 WP_003901156.1.77348 WP_003901156.1.77351 WP_003901156.1.77352 WP_003901156.1.77361 WP_003901156.1.774 WP_003901156.1.7740 WP_003901156.1.77404 WP_003901156.1.77425 WP_003901156.1.77463 WP_003901156.1.77474 WP_003901156.1.7748 WP_003901156.1.77484 WP_003901156.1.77491 WP_003901156.1.77499 WP_003901156.1.77510 WP_003901156.1.77530 WP_003901156.1.77554 WP_003901156.1.77559 WP_003901156.1.77599 WP_003901156.1.77605 WP_003901156.1.7762 WP_003901156.1.77627 WP_003901156.1.77649 WP_003901156.1.77654 WP_003901156.1.7766 WP_003901156.1.77667 WP_003901156.1.77704 WP_003901156.1.77706 WP_003901156.1.77726 WP_003901156.1.77774 WP_003901156.1.7778 WP_003901156.1.77790 WP_003901156.1.77809 WP_003901156.1.77820 WP_003901156.1.77843 WP_003901156.1.77855 WP_003901156.1.77865 WP_003901156.1.77868 WP_003901156.1.77879 WP_003901156.1.77890 WP_003901156.1.77909 WP_003901156.1.77911 WP_003901156.1.77931 WP_003901156.1.77984 WP_003901156.1.78020 WP_003901156.1.78024 WP_003901156.1.78075 WP_003901156.1.78084 WP_003901156.1.78086 WP_003901156.1.7809 WP_003901156.1.78098 WP_003901156.1.78105 WP_003901156.1.78113 WP_003901156.1.78136 WP_003901156.1.78162 WP_003901156.1.7817 WP_003901156.1.78200 WP_003901156.1.78216 WP_003901156.1.78236 WP_003901156.1.78238 WP_003901156.1.78322 WP_003901156.1.78338 WP_003901156.1.7836 WP_003901156.1.78360 WP_003901156.1.78386 WP_003901156.1.78435 WP_003901156.1.7844 WP_003901156.1.78459 WP_003901156.1.78488 WP_003901156.1.7849 WP_003901156.1.78499 WP_003901156.1.785 WP_003901156.1.78516 WP_003901156.1.78524 WP_003901156.1.78526 WP_003901156.1.78538 WP_003901156.1.78544 WP_003901156.1.78545 WP_003901156.1.78547 WP_003901156.1.78574 WP_003901156.1.78580 WP_003901156.1.7860 WP_003901156.1.78620 WP_003901156.1.78646 WP_003901156.1.78648 WP_003901156.1.78649 WP_003901156.1.78655 WP_003901156.1.78657 WP_003901156.1.78659 WP_003901156.1.7869 WP_003901156.1.78692 WP_003901156.1.78760 WP_003901156.1.78766 WP_003901156.1.78776 WP_003901156.1.78778 WP_003901156.1.78784 WP_003901156.1.78788 WP_003901156.1.78790 WP_003901156.1.78793 WP_003901156.1.78848 WP_003901156.1.78860 WP_003901156.1.7887 WP_003901156.1.78884 WP_003901156.1.78932 WP_003901156.1.78969 WP_003901156.1.78977 WP_003901156.1.78980 WP_003901156.1.79005 WP_003901156.1.79016 WP_003901156.1.79033 WP_003901156.1.79064 WP_003901156.1.79066 WP_003901156.1.79068 WP_003901156.1.79077 WP_003901156.1.79095 WP_003901156.1.79112 WP_003901156.1.79122 WP_003901156.1.79145 WP_003901156.1.79152 WP_003901156.1.79163 WP_003901156.1.79182 WP_003901156.1.79198 WP_003901156.1.79213 WP_003901156.1.79218 WP_003901156.1.79268 WP_003901156.1.79273 WP_003901156.1.79278 WP_003901156.1.79290 WP_003901156.1.79319 WP_003901156.1.79325 WP_003901156.1.79326 WP_003901156.1.7933 WP_003901156.1.79330 WP_003901156.1.79339 WP_003901156.1.79394 WP_003901156.1.79399 WP_003901156.1.79413 WP_003901156.1.79422 WP_003901156.1.79445 WP_003901156.1.79447 WP_003901156.1.79455 WP_003901156.1.79471 WP_003901156.1.79480 WP_003901156.1.79482 WP_003901156.1.79488 WP_003901156.1.79500 WP_003901156.1.79502 WP_003901156.1.79508 WP_003901156.1.79514 WP_003901156.1.79561 WP_003901156.1.79565 WP_003901156.1.79578 WP_003901156.1.79588 WP_003901156.1.79598 WP_003901156.1.79615 WP_003901156.1.79684 WP_003901156.1.79698 WP_003901156.1.797 WP_003901156.1.79744 WP_003901156.1.79784 WP_003901156.1.79802 WP_003901156.1.79806 WP_003901156.1.79819 WP_003901156.1.79826 WP_003901156.1.79828 WP_003901156.1.79851 WP_003901156.1.79853 WP_003901156.1.79863 WP_003901156.1.79881 WP_003901156.1.79885 WP_003901156.1.79898 WP_003901156.1.7990 WP_003901156.1.79900 WP_003901156.1.79913 WP_003901156.1.79918 WP_003901156.1.79947 WP_003901156.1.79948 WP_003901156.1.7995 WP_003901156.1.7997 WP_003901156.1.80004 WP_003901156.1.80015 WP_003901156.1.80022 WP_003901156.1.80030 WP_003901156.1.80054 WP_003901156.1.80084 WP_003901156.1.80099 WP_003901156.1.80129 WP_003901156.1.80177 WP_003901156.1.80234 WP_003901156.1.8026 WP_003901156.1.80275 WP_003901156.1.8029 WP_003901156.1.80299 WP_003901156.1.80300 WP_003901156.1.80304 WP_003901156.1.80326 WP_003901156.1.80351 WP_003901156.1.8037 WP_003901156.1.80370 WP_003901156.1.80399 WP_003901156.1.8044 WP_003901156.1.80451 WP_003901156.1.80458 WP_003901156.1.80461 WP_003901156.1.80490 WP_003901156.1.80503 WP_003901156.1.80507 WP_003901156.1.80552 WP_003901156.1.80576 WP_003901156.1.80588 WP_003901156.1.80599 WP_003901156.1.8060 WP_003901156.1.80624 WP_003901156.1.80636 WP_003901156.1.80711 WP_003901156.1.80714 WP_003901156.1.80743 WP_003901156.1.80784 WP_003901156.1.80815 WP_003901156.1.80853 WP_003901156.1.80918 WP_003901156.1.8093 WP_003901156.1.80967 WP_003901156.1.8097 WP_003901156.1.80988 WP_003901156.1.81007 WP_003901156.1.81013 WP_003901156.1.8105 WP_003901156.1.81059 WP_003901156.1.81066 WP_003901156.1.81075 WP_003901156.1.81091 WP_003901156.1.81119 WP_003901156.1.81125 WP_003901156.1.81136 WP_003901156.1.8114 WP_003901156.1.81189 WP_003901156.1.81192 WP_003901156.1.812 WP_003901156.1.81230 WP_003901156.1.81249 WP_003901156.1.81250 WP_003901156.1.81264 WP_003901156.1.8128 WP_003901156.1.81287 WP_003901156.1.81297 WP_003901156.1.8138 WP_003901156.1.81407 WP_003901156.1.8143 WP_003901156.1.81439 WP_003901156.1.81465 WP_003901156.1.81505 WP_003901156.1.81529 WP_003901156.1.81538 WP_003901156.1.81541 WP_003901156.1.81560 WP_003901156.1.81561 WP_003901156.1.81567 WP_003901156.1.81583 WP_003901156.1.81686 WP_003901156.1.81712 WP_003901156.1.81720 WP_003901156.1.81731 WP_003901156.1.81774 WP_003901156.1.81788 WP_003901156.1.81809 WP_003901156.1.81820 WP_003901156.1.81850 WP_003901156.1.81883 WP_003901156.1.81891 WP_003901156.1.81911 WP_003901156.1.81918 WP_003901156.1.82011 WP_003901156.1.82048 WP_003901156.1.82069 WP_003901156.1.82071 WP_003901156.1.82108 WP_003901156.1.82136 WP_003901156.1.82142 WP_003901156.1.8215 WP_003901156.1.82158 WP_003901156.1.8217 WP_003901156.1.82209 WP_003901156.1.82210 WP_003901156.1.82228 WP_003901156.1.82236 WP_003901156.1.82251 WP_003901156.1.82271 WP_003901156.1.82305 WP_003901156.1.82307 WP_003901156.1.82317 WP_003901156.1.8232 WP_003901156.1.82346 WP_003901156.1.82374 WP_003901156.1.82385 WP_003901156.1.82429 WP_003901156.1.82460 WP_003901156.1.82462 WP_003901156.1.82483 WP_003901156.1.82494 WP_003901156.1.82531 WP_003901156.1.82546 WP_003901156.1.82547 WP_003901156.1.82549 WP_003901156.1.82577 WP_003901156.1.82592 WP_003901156.1.82597 WP_003901156.1.82598 WP_003901156.1.82625 WP_003901156.1.82642 WP_003901156.1.82651 WP_003901156.1.82653 WP_003901156.1.82681 WP_003901156.1.82685 WP_003901156.1.8271 WP_003901156.1.82712 WP_003901156.1.8273 WP_003901156.1.82743 WP_003901156.1.82757 WP_003901156.1.82774 WP_003901156.1.82803 WP_003901156.1.82860 WP_003901156.1.82871 WP_003901156.1.82892 WP_003901156.1.82935 WP_003901156.1.82957 WP_003901156.1.82973 WP_003901156.1.82981 WP_003901156.1.82983 WP_003901156.1.83004 WP_003901156.1.83009 WP_003901156.1.83044 WP_003901156.1.83065 WP_003901156.1.83074 WP_003901156.1.83110 WP_003901156.1.83146 WP_003901156.1.83149 WP_003901156.1.83159 WP_003901156.1.8317 WP_003901156.1.83173 WP_003901156.1.83181 WP_003901156.1.83182 WP_003901156.1.83191 WP_003901156.1.83197 WP_003901156.1.83212 WP_003901156.1.8326 WP_003901156.1.83262 WP_003901156.1.83268 WP_003901156.1.83273 WP_003901156.1.83309 WP_003901156.1.83332 WP_003901156.1.83334 WP_003901156.1.83341 WP_003901156.1.83349 WP_003901156.1.8335 WP_003901156.1.83353 WP_003901156.1.83367 WP_003901156.1.83380 WP_003901156.1.83381 WP_003901156.1.83389 WP_003901156.1.83408 WP_003901156.1.83409 WP_003901156.1.83435 WP_003901156.1.83470 WP_003901156.1.83524 WP_003901156.1.83526 WP_003901156.1.8358 WP_003901156.1.83601 WP_003901156.1.83611 WP_003901156.1.83638 WP_003901156.1.83648 WP_003901156.1.83656 WP_003901156.1.83667 WP_003901156.1.83689 WP_003901156.1.83692 WP_003901156.1.83705 WP_003901156.1.83766 WP_003901156.1.83793 WP_003901156.1.83794 WP_003901156.1.83802 WP_003901156.1.83805 WP_003901156.1.83839 WP_003901156.1.83842 WP_003901156.1.83850 WP_003901156.1.83861 WP_003901156.1.83884 WP_003901156.1.83920 WP_003901156.1.83929 WP_003901156.1.83930 WP_003901156.1.83975 WP_003901156.1.83991 WP_003901156.1.8400 WP_003901156.1.84027 WP_003901156.1.8404 WP_003901156.1.84057 WP_003901156.1.84070 WP_003901156.1.8409 WP_003901156.1.84112 WP_003901156.1.84146 WP_003901156.1.8415 WP_003901156.1.84176 WP_003901156.1.84192 WP_003901156.1.84228 WP_003901156.1.8424 WP_003901156.1.84244 WP_003901156.1.84259 WP_003901156.1.8426 WP_003901156.1.84277 WP_003901156.1.84287 WP_003901156.1.8434 WP_003901156.1.84388 WP_003901156.1.84409 WP_003901156.1.84438 WP_003901156.1.84460 WP_003901156.1.84488 WP_003901156.1.84504 WP_003901156.1.84525 WP_003901156.1.84620 WP_003901156.1.84623 WP_003901156.1.84641 WP_003901156.1.84655 WP_003901156.1.84666 WP_003901156.1.84670 WP_003901156.1.84739 WP_003901156.1.84748 WP_003901156.1.84766 WP_003901156.1.84772 WP_003901156.1.84774 WP_003901156.1.848 WP_003901156.1.84812 WP_003901156.1.84836 WP_003901156.1.84839 WP_003901156.1.84846 WP_003901156.1.84873 WP_003901156.1.84911 WP_003901156.1.84938 WP_003901156.1.84968 WP_003901156.1.84973 WP_003901156.1.84981 WP_003901156.1.84985 WP_003901156.1.8503 WP_003901156.1.85038 WP_003901156.1.85041 WP_003901156.1.85043 WP_003901156.1.8505 WP_003901156.1.85074 WP_003901156.1.8509 WP_003901156.1.8512 WP_003901156.1.85148 WP_003901156.1.8518 WP_003901156.1.8522 WP_003901156.1.85242 WP_003901156.1.85276 WP_003901156.1.85281 WP_003901156.1.85284 WP_003901156.1.85314 WP_003901156.1.85319 WP_003901156.1.85330 WP_003901156.1.85341 WP_003901156.1.8535 WP_003901156.1.85363 WP_003901156.1.85371 WP_003901156.1.85377 WP_003901156.1.85387 WP_003901156.1.85399 WP_003901156.1.85458 WP_003901156.1.8546 WP_003901156.1.85464 WP_003901156.1.85478 WP_003901156.1.85480 WP_003901156.1.85488 WP_003901156.1.85495 WP_003901156.1.85551 WP_003901156.1.85557 WP_003901156.1.85577 WP_003901156.1.85597 WP_003901156.1.85599 WP_003901156.1.85610 WP_003901156.1.8563 WP_003901156.1.85648 WP_003901156.1.85679 WP_003901156.1.85704 WP_003901156.1.85727 WP_003901156.1.85737 WP_003901156.1.85763 WP_003901156.1.85808 WP_003901156.1.85819 WP_003901156.1.85820 WP_003901156.1.85823 WP_003901156.1.85832 WP_003901156.1.8586 WP_003901156.1.85872 WP_003901156.1.85894 WP_003901156.1.85909 WP_003901156.1.85913 WP_003901156.1.85953 WP_003901156.1.85986 WP_003901156.1.86000 WP_003901156.1.86024 WP_003901156.1.86025 WP_003901156.1.86032 WP_003901156.1.86048 WP_003901156.1.86052 WP_003901156.1.86067 WP_003901156.1.86103 WP_003901156.1.86122 WP_003901156.1.86124 WP_003901156.1.86160 WP_003901156.1.86164 WP_003901156.1.86168 WP_003901156.1.86190 WP_003901156.1.86204 WP_003901156.1.86208 WP_003901156.1.86235 WP_003901156.1.86249 WP_003901156.1.86260 WP_003901156.1.86290 WP_003901156.1.863 WP_003901156.1.86327 WP_003901156.1.86334 WP_003901156.1.86337 WP_003901156.1.86368 WP_003901156.1.86377 WP_003901156.1.86425 WP_003901156.1.86459 WP_003901156.1.8649 WP_003901156.1.86499 WP_003901156.1.86520 WP_003901156.1.86561 WP_003901156.1.86568 WP_003901156.1.86575 WP_003901156.1.86584 WP_003901156.1.86605 WP_003901156.1.86626 WP_003901156.1.86648 WP_003901156.1.8666 WP_003901156.1.86684 WP_003901156.1.86696 WP_003901156.1.86705 WP_003901156.1.86718 WP_003901156.1.86725 WP_003901156.1.86757 WP_003901156.1.86766 WP_003901156.1.86801 WP_003901156.1.86814 WP_003901156.1.86820 WP_003901156.1.86825 WP_003901156.1.86834 WP_003901156.1.8685 WP_003901156.1.86851 WP_003901156.1.86855 WP_003901156.1.86867 WP_003901156.1.86877 WP_003901156.1.86883 WP_003901156.1.8689 WP_003901156.1.86892 WP_003901156.1.86933 WP_003901156.1.86941 WP_003901156.1.86950 WP_003901156.1.86962 WP_003901156.1.86963 WP_003901156.1.86979 WP_003901156.1.8700 WP_003901156.1.87001 WP_003901156.1.87002 WP_003901156.1.87031 WP_003901156.1.87116 WP_003901156.1.87117 WP_003901156.1.8714 WP_003901156.1.87178 WP_003901156.1.87191 WP_003901156.1.87201 WP_003901156.1.87209 WP_003901156.1.87240 WP_003901156.1.87266 WP_003901156.1.87273 WP_003901156.1.87275 WP_003901156.1.8733 WP_003901156.1.87345 WP_003901156.1.87369 WP_003901156.1.8737 WP_003901156.1.87401 WP_003901156.1.87404 WP_003901156.1.87406 WP_003901156.1.87409 WP_003901156.1.87444 WP_003901156.1.87459 WP_003901156.1.87472 WP_003901156.1.87489 WP_003901156.1.87494 WP_003901156.1.87496 WP_003901156.1.87582 WP_003901156.1.87588 WP_003901156.1.87617 WP_003901156.1.87619 WP_003901156.1.87620 WP_003901156.1.87634 WP_003901156.1.87643 WP_003901156.1.8765 WP_003901156.1.87650 WP_003901156.1.87654 WP_003901156.1.87658 WP_003901156.1.87665 WP_003901156.1.87676 WP_003901156.1.87677 WP_003901156.1.87684 WP_003901156.1.87692 WP_003901156.1.87707 WP_003901156.1.87732 WP_003901156.1.87784 WP_003901156.1.87796 WP_003901156.1.87809 WP_003901156.1.87817 WP_003901156.1.87827 WP_003901156.1.87831 WP_003901156.1.87835 WP_003901156.1.87837 WP_003901156.1.87866 WP_003901156.1.8789 WP_003901156.1.87911 WP_003901156.1.87924 WP_003901156.1.87951 WP_003901156.1.87955 WP_003901156.1.87956 WP_003901156.1.87991 WP_003901156.1.88 WP_003901156.1.88002 WP_003901156.1.88037 WP_003901156.1.88039 WP_003901156.1.88072 WP_003901156.1.88077 WP_003901156.1.88121 WP_003901156.1.88180 WP_003901156.1.88191 WP_003901156.1.88205 WP_003901156.1.88217 WP_003901156.1.88219 WP_003901156.1.88245 WP_003901156.1.88253 WP_003901156.1.88294 WP_003901156.1.88315 WP_003901156.1.88316 WP_003901156.1.88320 WP_003901156.1.88338 WP_003901156.1.8840 WP_003901156.1.88437 WP_003901156.1.88453 WP_003901156.1.88469 WP_003901156.1.88489 WP_003901156.1.88507 WP_003901156.1.88521 WP_003901156.1.88530 WP_003901156.1.88537 WP_003901156.1.88541 WP_003901156.1.88592 WP_003901156.1.88616 WP_003901156.1.88618 WP_003901156.1.8862 WP_003901156.1.88625 WP_003901156.1.88632 WP_003901156.1.88634 WP_003901156.1.88649 WP_003901156.1.8870 WP_003901156.1.88737 WP_003901156.1.88756 WP_003901156.1.888 WP_003901156.1.88824 WP_003901156.1.88886 WP_003901156.1.88965 WP_003901156.1.88985 WP_003901156.1.8902 WP_003901156.1.89025 WP_003901156.1.89041 WP_003901156.1.89046 WP_003901156.1.89082 WP_003901156.1.89162 WP_003901156.1.89168 WP_003901156.1.8917 WP_003901156.1.89193 WP_003901156.1.89205 WP_003901156.1.89207 WP_003901156.1.89225 WP_003901156.1.8925 WP_003901156.1.89277 WP_003901156.1.89286 WP_003901156.1.89293 WP_003901156.1.89320 WP_003901156.1.8935 WP_003901156.1.89371 WP_003901156.1.89378 WP_003901156.1.89406 WP_003901156.1.8943 WP_003901156.1.89451 WP_003901156.1.89453 WP_003901156.1.89473 WP_003901156.1.89475 WP_003901156.1.89483 WP_003901156.1.895 WP_003901156.1.89513 WP_003901156.1.89517 WP_003901156.1.89522 WP_003901156.1.8954 WP_003901156.1.89543 WP_003901156.1.89567 WP_003901156.1.8957 WP_003901156.1.89572 WP_003901156.1.89589 WP_003901156.1.89607 WP_003901156.1.89613 WP_003901156.1.89625 WP_003901156.1.89648 WP_003901156.1.8967 WP_003901156.1.89670 WP_003901156.1.89676 WP_003901156.1.89729 WP_003901156.1.89739 WP_003901156.1.89762 WP_003901156.1.8977 WP_003901156.1.89808 WP_003901156.1.8982 WP_003901156.1.89829 WP_003901156.1.89831 WP_003901156.1.89844 WP_003901156.1.89849 WP_003901156.1.8989 WP_003901156.1.89901 WP_003901156.1.89903 WP_003901156.1.89909 WP_003901156.1.89922 WP_003901156.1.89926 WP_003901156.1.89963 WP_003901156.1.89971 WP_003901156.1.8998 WP_003901156.1.89987 WP_003901156.1.900 WP_003901156.1.90048 WP_003901156.1.9007 WP_003901156.1.90080 WP_003901156.1.90130 WP_003901156.1.90134 WP_003901156.1.90137 WP_003901156.1.90157 WP_003901156.1.90184 WP_003901156.1.90199 WP_003901156.1.90231 WP_003901156.1.90245 WP_003901156.1.90308 WP_003901156.1.90322 WP_003901156.1.90328 WP_003901156.1.90372 WP_003901156.1.90439 WP_003901156.1.90481 WP_003901156.1.90499 WP_003901156.1.9050 WP_003901156.1.90527 WP_003901156.1.90550 WP_003901156.1.90560 WP_003901156.1.90612 WP_003901156.1.90640 WP_003901156.1.90672 WP_003901156.1.90687 WP_003901156.1.90691 WP_003901156.1.90711 WP_003901156.1.90722 WP_003901156.1.90744 WP_003901156.1.9075 WP_003901156.1.90756 WP_003901156.1.90767 WP_003901156.1.90771 WP_003901156.1.90785 WP_003901156.1.90788 WP_003901156.1.90800 WP_003901156.1.90810 WP_003901156.1.90816 WP_003901156.1.90819 WP_003901156.1.9082 WP_003901156.1.90831 WP_003901156.1.90884 WP_003901156.1.90899 WP_003901156.1.90906 WP_003901156.1.90958 WP_003901156.1.90976 WP_003901156.1.90977 WP_003901156.1.90987 WP_003901156.1.9102 WP_003901156.1.91026 WP_003901156.1.91032 WP_003901156.1.91043 WP_003901156.1.91053 WP_003901156.1.91082 WP_003901156.1.91106 WP_003901156.1.91112 WP_003901156.1.91144 WP_003901156.1.91151 WP_003901156.1.91157 WP_003901156.1.91167 WP_003901156.1.91169 WP_003901156.1.91192 WP_003901156.1.91201 WP_003901156.1.91207 WP_003901156.1.91208 WP_003901156.1.91211 WP_003901156.1.91214 WP_003901156.1.91230 WP_003901156.1.91244 WP_003901156.1.91251 WP_003901156.1.91260 WP_003901156.1.91265 WP_003901156.1.9128 WP_003901156.1.91284 WP_003901156.1.91294 WP_003901156.1.91303 WP_003901156.1.91322 WP_003901156.1.91352 WP_003901156.1.91386 WP_003901156.1.9139 WP_003901156.1.91398 WP_003901156.1.91411 WP_003901156.1.91430 WP_003901156.1.91436 WP_003901156.1.91483 WP_003901156.1.91507 WP_003901156.1.91508 WP_003901156.1.91576 WP_003901156.1.91589 WP_003901156.1.91694 WP_003901156.1.91695 WP_003901156.1.91713 WP_003901156.1.91717 WP_003901156.1.91728 WP_003901156.1.91743 WP_003901156.1.91759 WP_003901156.1.91784 WP_003901156.1.91785 WP_003901156.1.91786 WP_003901156.1.91802 WP_003901156.1.91828 WP_003901156.1.9189 WP_003901156.1.91896 WP_003901156.1.9190 WP_003901156.1.91915 WP_003901156.1.91931 WP_003901156.1.91937 WP_003901156.1.91944 WP_003901156.1.91953 WP_003901156.1.91957 WP_003901156.1.91976 WP_003901156.1.91978 WP_003901156.1.92021 WP_003901156.1.92083 WP_003901156.1.92127 WP_003901156.1.92144 WP_003901156.1.92150 WP_003901156.1.92153 WP_003901156.1.92190 WP_003901156.1.92192 WP_003901156.1.92200 WP_003901156.1.92220 WP_003901156.1.92221 WP_003901156.1.92222 WP_003901156.1.92273 WP_003901156.1.92289 WP_003901156.1.9229 WP_003901156.1.92294 WP_003901156.1.92300 WP_003901156.1.92317 WP_003901156.1.92334 WP_003901156.1.92338 WP_003901156.1.92345 WP_003901156.1.92356 WP_003901156.1.92364 WP_003901156.1.92380 WP_003901156.1.92428 WP_003901156.1.92447 WP_003901156.1.92456 WP_003901156.1.92467 WP_003901156.1.92471 WP_003901156.1.92490 WP_003901156.1.92508 WP_003901156.1.9251 WP_003901156.1.92511 WP_003901156.1.92523 WP_003901156.1.92527 WP_003901156.1.92536 WP_003901156.1.92592 WP_003901156.1.92597 WP_003901156.1.92603 WP_003901156.1.92606 WP_003901156.1.92610 WP_003901156.1.92613 WP_003901156.1.9263 WP_003901156.1.9265 WP_003901156.1.92650 WP_003901156.1.92660 WP_003901156.1.92677 WP_003901156.1.92685 WP_003901156.1.92689 WP_003901156.1.92690 WP_003901156.1.92714 WP_003901156.1.92736 WP_003901156.1.9274 WP_003901156.1.92752 WP_003901156.1.92760 WP_003901156.1.92777 WP_003901156.1.92803 WP_003901156.1.92833 WP_003901156.1.92856 WP_003901156.1.92881 WP_003901156.1.92892 WP_003901156.1.92907 WP_003901156.1.92908 WP_003901156.1.9291 WP_003901156.1.92917 WP_003901156.1.92996 WP_003901156.1.93006 WP_003901156.1.93008 WP_003901156.1.93009 WP_003901156.1.93015 WP_003901156.1.93043 WP_003901156.1.9307 WP_003901156.1.93083 WP_003901156.1.93097 WP_003901156.1.93137 WP_003901156.1.93192 WP_003901156.1.93203 WP_003901156.1.93212 WP_003901156.1.93234 WP_003901156.1.93245 WP_003901156.1.93257 WP_003901156.1.93265 WP_003901156.1.93297 WP_003901156.1.93320 WP_003901156.1.93328 WP_003901156.1.93337 WP_003901156.1.93343 WP_003901156.1.93349 WP_003901156.1.93363 WP_003901156.1.93377 WP_003901156.1.9338 WP_003901156.1.93407 WP_003901156.1.93417 WP_003901156.1.93419 WP_003901156.1.93426 WP_003901156.1.9344 WP_003901156.1.93443 WP_003901156.1.93447 WP_003901156.1.93470 WP_003901156.1.93483 WP_003901156.1.93487 WP_003901156.1.93495 WP_003901156.1.93499 WP_003901156.1.93516 WP_003901156.1.93536 WP_003901156.1.93544 WP_003901156.1.93555 WP_003901156.1.93560 WP_003901156.1.93564 WP_003901156.1.9357 WP_003901156.1.93573 WP_003901156.1.93576 WP_003901156.1.93588 WP_003901156.1.9363 WP_003901156.1.93645 WP_003901156.1.93649 WP_003901156.1.93659 WP_003901156.1.93677 WP_003901156.1.9368 WP_003901156.1.93689 WP_003901156.1.93693 WP_003901156.1.93698 WP_003901156.1.93706 WP_003901156.1.9371 WP_003901156.1.93792 WP_003901156.1.93823 WP_003901156.1.93871 WP_003901156.1.9388 WP_003901156.1.93894 WP_003901156.1.93903 WP_003901156.1.93907 WP_003901156.1.93913 WP_003901156.1.93946 WP_003901156.1.93950 WP_003901156.1.93953 WP_003901156.1.93954 WP_003901156.1.93988 WP_003901156.1.9407 WP_003901156.1.94143 WP_003901156.1.94154 WP_003901156.1.94204 WP_003901156.1.94205 WP_003901156.1.94226 WP_003901156.1.94231 WP_003901156.1.94256 WP_003901156.1.94261 WP_003901156.1.94281 WP_003901156.1.94292 WP_003901156.1.94297 WP_003901156.1.9431 WP_003901156.1.94326 WP_003901156.1.94339 WP_003901156.1.94392 WP_003901156.1.94416 WP_003901156.1.94421 WP_003901156.1.94456 WP_003901156.1.94480 WP_003901156.1.94495 WP_003901156.1.94511 WP_003901156.1.94512 WP_003901156.1.94528 WP_003901156.1.94564 WP_003901156.1.946 WP_003901156.1.94602 WP_003901156.1.94623 WP_003901156.1.94629 WP_003901156.1.9465 WP_003901156.1.94673 WP_003901156.1.94714 WP_003901156.1.94730 WP_003901156.1.94736 WP_003901156.1.94776 WP_003901156.1.9478 WP_003901156.1.94834 WP_003901156.1.94852 WP_003901156.1.94872 WP_003901156.1.94902 WP_003901156.1.94916 WP_003901156.1.94979 WP_003901156.1.94994 WP_003901156.1.94996 WP_003901156.1.94998 WP_003901156.1.95007 WP_003901156.1.95010 WP_003901156.1.95015 WP_003901156.1.95034 WP_003901156.1.95068 WP_003901156.1.95081 WP_003901156.1.95082 WP_003901156.1.9509 WP_003901156.1.95096 WP_003901156.1.95112 WP_003901156.1.95138 WP_003901156.1.95179 WP_003901156.1.95188 WP_003901156.1.95190 WP_003901156.1.95234 WP_003901156.1.95241 WP_003901156.1.95257 WP_003901156.1.95279 WP_003901156.1.9531 WP_003901156.1.95335 WP_003901156.1.95344 WP_003901156.1.9535 WP_003901156.1.95370 WP_003901156.1.95392 WP_003901156.1.95416 WP_003901156.1.95417 WP_003901156.1.95454 WP_003901156.1.95455 WP_003901156.1.95491 WP_003901156.1.95497 WP_003901156.1.95508 WP_003901156.1.95509 WP_003901156.1.95529 WP_003901156.1.95556 WP_003901156.1.95557 WP_003901156.1.95565 WP_003901156.1.95578 WP_003901156.1.95580 WP_003901156.1.95585 WP_003901156.1.95643 WP_003901156.1.95679 WP_003901156.1.95685 WP_003901156.1.957 WP_003901156.1.95724 WP_003901156.1.95727 WP_003901156.1.95730 WP_003901156.1.95735 WP_003901156.1.95758 WP_003901156.1.95772 WP_003901156.1.95797 WP_003901156.1.95839 WP_003901156.1.9585 WP_003901156.1.9590 WP_003901156.1.95902 WP_003901156.1.95908 WP_003901156.1.95924 WP_003901156.1.95926 WP_003901156.1.95953 WP_003901156.1.95958 WP_003901156.1.95964 WP_003901156.1.95973 WP_003901156.1.96006 WP_003901156.1.96036 WP_003901156.1.96062 WP_003901156.1.96065 WP_003901156.1.96098 WP_003901156.1.96146 WP_003901156.1.96166 WP_003901156.1.96171 WP_003901156.1.96182 WP_003901156.1.96204 WP_003901156.1.96230 WP_003901156.1.96235 WP_003901156.1.96242 WP_003901156.1.96245 WP_003901156.1.96254 WP_003901156.1.96259 WP_003901156.1.96286 WP_003901156.1.96313 WP_003901156.1.96318 WP_003901156.1.96345 WP_003901156.1.96360 WP_003901156.1.96373 WP_003901156.1.96456 WP_003901156.1.96486 WP_003901156.1.96560 WP_003901156.1.96569 WP_003901156.1.96573 WP_003901156.1.96575 WP_003901156.1.96576 WP_003901156.1.96611 WP_003901156.1.9667 WP_003901156.1.96681 WP_003901156.1.96726 WP_003901156.1.96733 WP_003901156.1.96742 WP_003901156.1.96754 WP_003901156.1.9678 WP_003901156.1.96832 WP_003901156.1.9685 WP_003901156.1.97008 WP_003901156.1.97009 WP_003901156.1.97056 WP_003901156.1.97084 WP_003901156.1.97087 WP_003901156.1.97094 WP_003901156.1.97096 WP_003901156.1.97099 WP_003901156.1.97108 WP_003901156.1.97113 WP_003901156.1.97122 WP_003901156.1.97127 WP_003901156.1.97129 WP_003901156.1.97136 WP_003901156.1.9716 WP_003901156.1.97176 WP_003901156.1.97222 WP_003901156.1.97223 WP_003901156.1.97242 WP_003901156.1.97270 WP_003901156.1.97283 WP_003901156.1.97296 WP_003901156.1.97321 WP_003901156.1.97325 WP_003901156.1.97330 WP_003901156.1.97366 WP_003901156.1.97376 WP_003901156.1.97380 WP_003901156.1.9739 WP_003901156.1.97462 WP_003901156.1.97517 WP_003901156.1.97519 WP_003901156.1.97535 WP_003901156.1.97540 WP_003901156.1.97545 WP_003901156.1.97546 WP_003901156.1.97550 WP_003901156.1.97577 WP_003901156.1.97584 WP_003901156.1.9759 WP_003901156.1.97591 WP_003901156.1.97596 WP_003901156.1.97609 WP_003901156.1.97618 WP_003901156.1.9763 WP_003901156.1.97669 WP_003901156.1.97673 WP_003901156.1.97700 WP_003901156.1.97701 WP_003901156.1.9773 WP_003901156.1.97730 WP_003901156.1.97740 WP_003901156.1.97751 WP_003901156.1.97754 WP_003901156.1.97797 WP_003901156.1.9782 WP_003901156.1.9784 WP_003901156.1.97888 WP_003901156.1.9790 WP_003901156.1.9795 WP_003901156.1.97951 WP_003901156.1.97958 WP_003901156.1.97966 WP_003901156.1.97977 WP_003901156.1.97979 WP_003901156.1.97995 WP_003901156.1.98018 WP_003901156.1.98034 WP_003901156.1.98052 WP_003901156.1.98071 WP_003901156.1.98072 WP_003901156.1.98113 WP_003901156.1.98114 WP_003901156.1.98128 WP_003901156.1.98181 WP_003901156.1.98188 WP_003901156.1.98189 WP_003901156.1.98213 WP_003901156.1.98225 WP_003901156.1.98291 WP_003901156.1.98335 WP_003901156.1.98350 WP_003901156.1.98395 WP_003901156.1.98412 WP_003901156.1.98441 WP_003901156.1.98443 WP_003901156.1.98462 WP_003901156.1.9848 WP_003901156.1.98482 WP_003901156.1.98486 WP_003901156.1.98488 WP_003901156.1.98503 WP_003901156.1.98516 WP_003901156.1.98524 WP_003901156.1.98536 WP_003901156.1.98541 WP_003901156.1.98566 WP_003901156.1.98576 WP_003901156.1.98590 WP_003901156.1.98594 WP_003901156.1.98599 WP_003901156.1.98629 WP_003901156.1.98645 WP_003901156.1.98646 WP_003901156.1.98649 WP_003901156.1.98656 WP_003901156.1.9867 WP_003901156.1.98674 WP_003901156.1.98697 WP_003901156.1.98701 WP_003901156.1.98739 WP_003901156.1.98749 WP_003901156.1.98765 WP_003901156.1.98770 WP_003901156.1.98777 WP_003901156.1.98778 WP_003901156.1.98802 WP_003901156.1.98838 WP_003901156.1.98850 WP_003901156.1.98906 WP_003901156.1.98935 WP_003901156.1.98948 WP_003901156.1.98953 WP_003901156.1.98984 WP_003901156.1.99000 WP_003901156.1.99023 WP_003901156.1.99030 WP_003901156.1.99037 WP_003901156.1.99055 WP_003901156.1.99062 WP_003901156.1.99086 WP_003901156.1.99115 WP_003901156.1.99117 WP_003901156.1.99161 WP_003901156.1.99176 WP_003901156.1.99205 WP_003901156.1.99211 WP_003901156.1.99216 WP_003901156.1.99222 WP_003901156.1.99251 WP_003901156.1.99269 WP_003901156.1.99294 WP_003901156.1.99312 WP_003901156.1.99315 WP_003901156.1.99316 WP_003901156.1.99322 WP_003901156.1.99328 WP_003901156.1.99365 WP_003901156.1.99368 WP_003901156.1.99396 WP_003901156.1.99402 WP_003901156.1.99404 WP_003901156.1.99419 WP_003901156.1.99438 WP_003901156.1.99460 WP_003901156.1.99468 WP_003901156.1.99473 WP_003901156.1.99513 WP_003901156.1.99529 WP_003901156.1.99548 WP_003901156.1.99572 WP_003901156.1.99575 WP_003901156.1.99578 WP_003901156.1.99605 WP_003901156.1.99609 WP_003901156.1.99617 WP_003901156.1.99635 WP_003901156.1.99650 WP_003901156.1.99672 WP_003901156.1.99701 WP_003901156.1.99711 WP_003901156.1.99716 WP_003901156.1.99740 WP_003901156.1.99745 WP_003901156.1.99749 WP_003901156.1.9976 WP_003901156.1.99798 WP_003901156.1.99817 WP_003901156.1.99832 WP_003901156.1.99847 WP_003901156.1.99852 WP_003901156.1.99886 WP_003901156.1.99897 WP_003901156.1.99899 WP_003901156.1.99915 WP_003901156.1.9993 WP_003901156.1.99982 WP_003901156.1.99991 NYSGXRC-10032e gi|433626523|ref|YP_007260152.1| gi|121637353|ref|YP_977576.1| gi|385998207|ref|YP_005916505.1| gi|224989828|ref|YP_002644515.1| gi|340626437|ref|YP_004744889.1| gi|392432980|ref|YP_006474024.1| gi|378771187|ref|YP_005170920.1| gi|471337343|ref|YP_007610056.1| 233413.Mb1458 336982.TBFG_11452 410289.BCG_1484 419947.MRA_1432 561275.JTY_1459 83332.Rv1423 gi|15608561|ref|NP_215939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]