SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15608788|ref|NP_216166.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15608788|ref|NP_216166.1|
Domain Number 1 Region: 213-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-58
Family B3/B4 domain of PheRS, PheT 0.000018
Further Details:      
 
Domain Number 2 Region: 480-596,626-725
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.45e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0061
Further Details:      
 
Domain Number 3 Region: 49-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-32
Family Myf domain 0.0039
Further Details:      
 
Domain Number 4 Region: 735-830
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-26
Family Anticodon-binding domain of PheRS 0.0004
Further Details:      
 
Domain Number 5 Region: 416-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000032
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15608788|ref|NP_216166.1|
Sequence length 831
Comment Probable phenylalanyl-tRNA synthetase, beta chain PheT [Mycobacterium tuberculosis H37Rv]
Sequence
MRLPYSWLREVVAVGASGWDVTPGELEQTLLRIGHEVEEVIPLGPVDGPVTVGRVADIEE
LTGYKKPIRACAVDIGDRQYREIICGATNFAVGDLVVVALPGATLPGGFTISARKAYGRN
SDGMICSAAELNLGADHSGILVLPPGAAEPGADGAGVLGLDDVVFHLAITPDRGYCMSVR
GLARELACAYDLDFVDPASNSRVPPLPIEGPAWPLTVQPETGVRRFALRPVIGIDPAAVS
PWWLQRRLLLCGIRATCPAVDVTNYVMLELGHPMHAHDRNRISGTLGVRFARSGETAVTL
DGIERKLDTADVLIVDDAATAAIGGVMGAASTEVRADSTDVLLEAAIWDPAAVSRTQRRL
HLPSEAARRYERTVDPAISVAALDRCARLLADIAGGEVSPTLTDWRGDPPCDDWSPPPIR
MGVDVPDRIAGVAYPQGTTARRLAQIGAVVTHDGDTLTVTPPSWRPDLRQPADLVEEVLR
LEGLEVIPSVLPPAPAGRGLTAGQQRRRTIGRSLALSGYVEILPTPFLPAGVFDLWGLEA
DDSRRMTTRVLNPLEADRPQLATTLLPALLEALVRNVSRGLVDVALFAIAQVVQPTEQTR
GVGLIPVDRRPTDDEIAMLDASLPRQPQHVAAVLAGLREPRGPWGPGRPVEAADAFEAVR
IIARASRVDVTLRPAQYLPWHPGRCAQVFVGESSVGHAGQLHPAVIERSGLPKGTCAVEL
NLDAIPCSAPLPAPRVSPYPAVFQDVSLVVAADIPAQAVADAVRAGAGDLLEDIALFDVF
TGPQIGEHRKSLTFALRFRAPDRTLTEDDASAARDAAVQSAAERVGAVLRG
Download sequence
Identical sequences A0A045J098 A5U307 I6YB66 P9WFU0 P9WFU1
NP_216166.1.84033 WP_003901220.1.100021 WP_003901220.1.100069 WP_003901220.1.100087 WP_003901220.1.10015 WP_003901220.1.100208 WP_003901220.1.100216 WP_003901220.1.10022 WP_003901220.1.100255 WP_003901220.1.100260 WP_003901220.1.100270 WP_003901220.1.100279 WP_003901220.1.100308 WP_003901220.1.100338 WP_003901220.1.10037 WP_003901220.1.100396 WP_003901220.1.100459 WP_003901220.1.100552 WP_003901220.1.100625 WP_003901220.1.10064 WP_003901220.1.100666 WP_003901220.1.100677 WP_003901220.1.100697 WP_003901220.1.100703 WP_003901220.1.100716 WP_003901220.1.100722 WP_003901220.1.100754 WP_003901220.1.1008 WP_003901220.1.100812 WP_003901220.1.100866 WP_003901220.1.10088 WP_003901220.1.100889 WP_003901220.1.10090 WP_003901220.1.100910 WP_003901220.1.100915 WP_003901220.1.100918 WP_003901220.1.100935 WP_003901220.1.100984 WP_003901220.1.100998 WP_003901220.1.101 WP_003901220.1.101028 WP_003901220.1.101048 WP_003901220.1.101054 WP_003901220.1.101075 WP_003901220.1.10116 WP_003901220.1.10117 WP_003901220.1.101209 WP_003901220.1.10125 WP_003901220.1.101290 WP_003901220.1.101323 WP_003901220.1.101350 WP_003901220.1.101367 WP_003901220.1.101398 WP_003901220.1.101403 WP_003901220.1.101421 WP_003901220.1.10144 WP_003901220.1.101442 WP_003901220.1.101452 WP_003901220.1.101456 WP_003901220.1.101493 WP_003901220.1.101525 WP_003901220.1.101533 WP_003901220.1.101553 WP_003901220.1.101558 WP_003901220.1.101573 WP_003901220.1.10159 WP_003901220.1.101592 WP_003901220.1.101604 WP_003901220.1.101607 WP_003901220.1.101622 WP_003901220.1.101644 WP_003901220.1.101659 WP_003901220.1.101671 WP_003901220.1.101687 WP_003901220.1.101698 WP_003901220.1.10170 WP_003901220.1.101713 WP_003901220.1.101722 WP_003901220.1.101733 WP_003901220.1.101743 WP_003901220.1.101753 WP_003901220.1.101754 WP_003901220.1.101764 WP_003901220.1.101773 WP_003901220.1.101797 WP_003901220.1.101798 WP_003901220.1.101802 WP_003901220.1.101826 WP_003901220.1.101858 WP_003901220.1.101862 WP_003901220.1.101888 WP_003901220.1.101894 WP_003901220.1.101899 WP_003901220.1.1019 WP_003901220.1.101923 WP_003901220.1.101925 WP_003901220.1.10193 WP_003901220.1.102 WP_003901220.1.102017 WP_003901220.1.102053 WP_003901220.1.102063 WP_003901220.1.102099 WP_003901220.1.1021 WP_003901220.1.102119 WP_003901220.1.102121 WP_003901220.1.10224 WP_003901220.1.10253 WP_003901220.1.10262 WP_003901220.1.10272 WP_003901220.1.10277 WP_003901220.1.1033 WP_003901220.1.10350 WP_003901220.1.10362 WP_003901220.1.10366 WP_003901220.1.10376 WP_003901220.1.10396 WP_003901220.1.10410 WP_003901220.1.10430 WP_003901220.1.1044 WP_003901220.1.10471 WP_003901220.1.10472 WP_003901220.1.10489 WP_003901220.1.105 WP_003901220.1.10518 WP_003901220.1.10545 WP_003901220.1.1057 WP_003901220.1.10594 WP_003901220.1.10603 WP_003901220.1.10615 WP_003901220.1.10623 WP_003901220.1.10635 WP_003901220.1.10643 WP_003901220.1.10662 WP_003901220.1.10756 WP_003901220.1.10791 WP_003901220.1.10799 WP_003901220.1.10825 WP_003901220.1.10848 WP_003901220.1.10863 WP_003901220.1.10879 WP_003901220.1.10912 WP_003901220.1.10916 WP_003901220.1.10923 WP_003901220.1.1095 WP_003901220.1.10956 WP_003901220.1.10958 WP_003901220.1.10962 WP_003901220.1.10980 WP_003901220.1.10981 WP_003901220.1.10993 WP_003901220.1.1100 WP_003901220.1.11040 WP_003901220.1.11070 WP_003901220.1.11171 WP_003901220.1.11175 WP_003901220.1.11222 WP_003901220.1.11329 WP_003901220.1.1133 WP_003901220.1.11373 WP_003901220.1.11376 WP_003901220.1.11390 WP_003901220.1.11402 WP_003901220.1.11481 WP_003901220.1.11514 WP_003901220.1.11589 WP_003901220.1.11596 WP_003901220.1.11604 WP_003901220.1.11610 WP_003901220.1.11707 WP_003901220.1.11752 WP_003901220.1.11758 WP_003901220.1.11761 WP_003901220.1.11775 WP_003901220.1.11804 WP_003901220.1.11826 WP_003901220.1.11939 WP_003901220.1.11960 WP_003901220.1.11961 WP_003901220.1.11972 WP_003901220.1.120 WP_003901220.1.12001 WP_003901220.1.12049 WP_003901220.1.12052 WP_003901220.1.12100 WP_003901220.1.12116 WP_003901220.1.12133 WP_003901220.1.12161 WP_003901220.1.12165 WP_003901220.1.12190 WP_003901220.1.12216 WP_003901220.1.12265 WP_003901220.1.12275 WP_003901220.1.12294 WP_003901220.1.123 WP_003901220.1.1231 WP_003901220.1.12314 WP_003901220.1.12327 WP_003901220.1.1236 WP_003901220.1.12371 WP_003901220.1.12372 WP_003901220.1.1241 WP_003901220.1.12421 WP_003901220.1.12519 WP_003901220.1.12523 WP_003901220.1.12526 WP_003901220.1.1255 WP_003901220.1.12550 WP_003901220.1.12551 WP_003901220.1.12563 WP_003901220.1.12611 WP_003901220.1.12669 WP_003901220.1.12672 WP_003901220.1.12692 WP_003901220.1.1271 WP_003901220.1.12768 WP_003901220.1.1279 WP_003901220.1.12804 WP_003901220.1.12821 WP_003901220.1.12841 WP_003901220.1.12854 WP_003901220.1.12941 WP_003901220.1.12947 WP_003901220.1.12957 WP_003901220.1.12972 WP_003901220.1.13043 WP_003901220.1.13090 WP_003901220.1.13096 WP_003901220.1.13163 WP_003901220.1.13175 WP_003901220.1.13183 WP_003901220.1.132 WP_003901220.1.13249 WP_003901220.1.13282 WP_003901220.1.13284 WP_003901220.1.13298 WP_003901220.1.13306 WP_003901220.1.13312 WP_003901220.1.13321 WP_003901220.1.13345 WP_003901220.1.13358 WP_003901220.1.13370 WP_003901220.1.13420 WP_003901220.1.13433 WP_003901220.1.13435 WP_003901220.1.13438 WP_003901220.1.13461 WP_003901220.1.13466 WP_003901220.1.13489 WP_003901220.1.13551 WP_003901220.1.13561 WP_003901220.1.13564 WP_003901220.1.13579 WP_003901220.1.13687 WP_003901220.1.13697 WP_003901220.1.13719 WP_003901220.1.1377 WP_003901220.1.13774 WP_003901220.1.13786 WP_003901220.1.13793 WP_003901220.1.13794 WP_003901220.1.13817 WP_003901220.1.13834 WP_003901220.1.13866 WP_003901220.1.13880 WP_003901220.1.13909 WP_003901220.1.13919 WP_003901220.1.13920 WP_003901220.1.13952 WP_003901220.1.13953 WP_003901220.1.13962 WP_003901220.1.13988 WP_003901220.1.14027 WP_003901220.1.14046 WP_003901220.1.14115 WP_003901220.1.14158 WP_003901220.1.14162 WP_003901220.1.14178 WP_003901220.1.14195 WP_003901220.1.14208 WP_003901220.1.14238 WP_003901220.1.14266 WP_003901220.1.14273 WP_003901220.1.14303 WP_003901220.1.14306 WP_003901220.1.14307 WP_003901220.1.14310 WP_003901220.1.14382 WP_003901220.1.14416 WP_003901220.1.14428 WP_003901220.1.14469 WP_003901220.1.14477 WP_003901220.1.14504 WP_003901220.1.14514 WP_003901220.1.1452 WP_003901220.1.14527 WP_003901220.1.1454 WP_003901220.1.14544 WP_003901220.1.14548 WP_003901220.1.14551 WP_003901220.1.14561 WP_003901220.1.1462 WP_003901220.1.14667 WP_003901220.1.14675 WP_003901220.1.14694 WP_003901220.1.14695 WP_003901220.1.14709 WP_003901220.1.14766 WP_003901220.1.14865 WP_003901220.1.14872 WP_003901220.1.14926 WP_003901220.1.14951 WP_003901220.1.15003 WP_003901220.1.15028 WP_003901220.1.15040 WP_003901220.1.15052 WP_003901220.1.15065 WP_003901220.1.15072 WP_003901220.1.15089 WP_003901220.1.1509 WP_003901220.1.15131 WP_003901220.1.15168 WP_003901220.1.15174 WP_003901220.1.15210 WP_003901220.1.15216 WP_003901220.1.15217 WP_003901220.1.1523 WP_003901220.1.15232 WP_003901220.1.15238 WP_003901220.1.15240 WP_003901220.1.15253 WP_003901220.1.1527 WP_003901220.1.15292 WP_003901220.1.15299 WP_003901220.1.15302 WP_003901220.1.1534 WP_003901220.1.15365 WP_003901220.1.15387 WP_003901220.1.15442 WP_003901220.1.15449 WP_003901220.1.15481 WP_003901220.1.15492 WP_003901220.1.15512 WP_003901220.1.15559 WP_003901220.1.1560 WP_003901220.1.15611 WP_003901220.1.1563 WP_003901220.1.15643 WP_003901220.1.15688 WP_003901220.1.15755 WP_003901220.1.15763 WP_003901220.1.15774 WP_003901220.1.1578 WP_003901220.1.15780 WP_003901220.1.15834 WP_003901220.1.15842 WP_003901220.1.15853 WP_003901220.1.15870 WP_003901220.1.15893 WP_003901220.1.15946 WP_003901220.1.15958 WP_003901220.1.15987 WP_003901220.1.15993 WP_003901220.1.16009 WP_003901220.1.16025 WP_003901220.1.16043 WP_003901220.1.16066 WP_003901220.1.16069 WP_003901220.1.16106 WP_003901220.1.16108 WP_003901220.1.16136 WP_003901220.1.16139 WP_003901220.1.16141 WP_003901220.1.16143 WP_003901220.1.1630 WP_003901220.1.16318 WP_003901220.1.1632 WP_003901220.1.16334 WP_003901220.1.16341 WP_003901220.1.16345 WP_003901220.1.16384 WP_003901220.1.16386 WP_003901220.1.164 WP_003901220.1.1642 WP_003901220.1.16424 WP_003901220.1.16438 WP_003901220.1.1644 WP_003901220.1.16451 WP_003901220.1.16476 WP_003901220.1.16480 WP_003901220.1.1652 WP_003901220.1.16549 WP_003901220.1.16560 WP_003901220.1.16598 WP_003901220.1.16609 WP_003901220.1.16619 WP_003901220.1.16620 WP_003901220.1.16637 WP_003901220.1.1669 WP_003901220.1.16707 WP_003901220.1.16743 WP_003901220.1.1683 WP_003901220.1.16837 WP_003901220.1.16852 WP_003901220.1.16937 WP_003901220.1.16940 WP_003901220.1.16950 WP_003901220.1.16959 WP_003901220.1.1697 WP_003901220.1.16977 WP_003901220.1.16987 WP_003901220.1.17005 WP_003901220.1.17010 WP_003901220.1.17015 WP_003901220.1.17019 WP_003901220.1.17052 WP_003901220.1.17057 WP_003901220.1.1707 WP_003901220.1.17094 WP_003901220.1.17130 WP_003901220.1.17138 WP_003901220.1.17147 WP_003901220.1.17224 WP_003901220.1.17251 WP_003901220.1.17288 WP_003901220.1.17304 WP_003901220.1.17345 WP_003901220.1.17391 WP_003901220.1.17412 WP_003901220.1.1743 WP_003901220.1.17483 WP_003901220.1.17505 WP_003901220.1.17527 WP_003901220.1.17535 WP_003901220.1.17540 WP_003901220.1.17553 WP_003901220.1.17558 WP_003901220.1.17599 WP_003901220.1.17635 WP_003901220.1.17655 WP_003901220.1.17679 WP_003901220.1.17687 WP_003901220.1.17700 WP_003901220.1.17710 WP_003901220.1.17713 WP_003901220.1.17722 WP_003901220.1.17746 WP_003901220.1.17788 WP_003901220.1.17798 WP_003901220.1.17803 WP_003901220.1.17816 WP_003901220.1.17821 WP_003901220.1.17830 WP_003901220.1.17868 WP_003901220.1.17878 WP_003901220.1.1792 WP_003901220.1.17923 WP_003901220.1.1795 WP_003901220.1.17973 WP_003901220.1.18009 WP_003901220.1.18065 WP_003901220.1.18070 WP_003901220.1.18116 WP_003901220.1.18120 WP_003901220.1.1817 WP_003901220.1.18170 WP_003901220.1.18206 WP_003901220.1.18216 WP_003901220.1.18257 WP_003901220.1.18297 WP_003901220.1.18364 WP_003901220.1.18411 WP_003901220.1.18444 WP_003901220.1.18448 WP_003901220.1.18476 WP_003901220.1.18522 WP_003901220.1.18580 WP_003901220.1.18587 WP_003901220.1.186 WP_003901220.1.18601 WP_003901220.1.18639 WP_003901220.1.18647 WP_003901220.1.1868 WP_003901220.1.18694 WP_003901220.1.18751 WP_003901220.1.18781 WP_003901220.1.18804 WP_003901220.1.18816 WP_003901220.1.18823 WP_003901220.1.18827 WP_003901220.1.18838 WP_003901220.1.18849 WP_003901220.1.18856 WP_003901220.1.18945 WP_003901220.1.1898 WP_003901220.1.19005 WP_003901220.1.19056 WP_003901220.1.19071 WP_003901220.1.19144 WP_003901220.1.19159 WP_003901220.1.19193 WP_003901220.1.19231 WP_003901220.1.19243 WP_003901220.1.19307 WP_003901220.1.19326 WP_003901220.1.19382 WP_003901220.1.19400 WP_003901220.1.19426 WP_003901220.1.19464 WP_003901220.1.19480 WP_003901220.1.19553 WP_003901220.1.19562 WP_003901220.1.19568 WP_003901220.1.19596 WP_003901220.1.19600 WP_003901220.1.19630 WP_003901220.1.1970 WP_003901220.1.19707 WP_003901220.1.19742 WP_003901220.1.19785 WP_003901220.1.19820 WP_003901220.1.19890 WP_003901220.1.19922 WP_003901220.1.19936 WP_003901220.1.19946 WP_003901220.1.19949 WP_003901220.1.19960 WP_003901220.1.19964 WP_003901220.1.20007 WP_003901220.1.20016 WP_003901220.1.20085 WP_003901220.1.20097 WP_003901220.1.20130 WP_003901220.1.20140 WP_003901220.1.20141 WP_003901220.1.20142 WP_003901220.1.20158 WP_003901220.1.20239 WP_003901220.1.20243 WP_003901220.1.20259 WP_003901220.1.20262 WP_003901220.1.20294 WP_003901220.1.20309 WP_003901220.1.20322 WP_003901220.1.20372 WP_003901220.1.204 WP_003901220.1.20427 WP_003901220.1.20457 WP_003901220.1.20459 WP_003901220.1.20542 WP_003901220.1.20578 WP_003901220.1.20608 WP_003901220.1.20628 WP_003901220.1.2066 WP_003901220.1.20707 WP_003901220.1.20722 WP_003901220.1.20742 WP_003901220.1.20751 WP_003901220.1.20776 WP_003901220.1.20843 WP_003901220.1.20850 WP_003901220.1.2086 WP_003901220.1.20868 WP_003901220.1.20876 WP_003901220.1.20897 WP_003901220.1.20898 WP_003901220.1.2090 WP_003901220.1.20911 WP_003901220.1.20921 WP_003901220.1.20926 WP_003901220.1.20927 WP_003901220.1.20951 WP_003901220.1.20970 WP_003901220.1.2104 WP_003901220.1.21127 WP_003901220.1.21135 WP_003901220.1.21173 WP_003901220.1.212 WP_003901220.1.2120 WP_003901220.1.21218 WP_003901220.1.21219 WP_003901220.1.21231 WP_003901220.1.21234 WP_003901220.1.2126 WP_003901220.1.21292 WP_003901220.1.21307 WP_003901220.1.2131 WP_003901220.1.21321 WP_003901220.1.21365 WP_003901220.1.21392 WP_003901220.1.21403 WP_003901220.1.21415 WP_003901220.1.21434 WP_003901220.1.21468 WP_003901220.1.21498 WP_003901220.1.21513 WP_003901220.1.21565 WP_003901220.1.21586 WP_003901220.1.21602 WP_003901220.1.21615 WP_003901220.1.21638 WP_003901220.1.21639 WP_003901220.1.21741 WP_003901220.1.21777 WP_003901220.1.21795 WP_003901220.1.218 WP_003901220.1.21826 WP_003901220.1.21829 WP_003901220.1.21843 WP_003901220.1.21872 WP_003901220.1.21873 WP_003901220.1.2188 WP_003901220.1.21882 WP_003901220.1.2194 WP_003901220.1.21941 WP_003901220.1.21956 WP_003901220.1.21958 WP_003901220.1.21971 WP_003901220.1.21973 WP_003901220.1.21983 WP_003901220.1.22003 WP_003901220.1.22013 WP_003901220.1.22075 WP_003901220.1.2212 WP_003901220.1.22127 WP_003901220.1.22140 WP_003901220.1.22233 WP_003901220.1.22255 WP_003901220.1.22277 WP_003901220.1.22348 WP_003901220.1.22366 WP_003901220.1.2238 WP_003901220.1.22380 WP_003901220.1.22438 WP_003901220.1.22511 WP_003901220.1.22524 WP_003901220.1.22585 WP_003901220.1.22606 WP_003901220.1.22609 WP_003901220.1.2262 WP_003901220.1.22624 WP_003901220.1.22629 WP_003901220.1.22665 WP_003901220.1.22670 WP_003901220.1.22725 WP_003901220.1.22728 WP_003901220.1.22737 WP_003901220.1.22754 WP_003901220.1.22800 WP_003901220.1.22804 WP_003901220.1.22840 WP_003901220.1.22844 WP_003901220.1.22970 WP_003901220.1.22996 WP_003901220.1.23032 WP_003901220.1.23101 WP_003901220.1.2312 WP_003901220.1.23153 WP_003901220.1.2320 WP_003901220.1.23204 WP_003901220.1.23216 WP_003901220.1.23229 WP_003901220.1.23233 WP_003901220.1.2326 WP_003901220.1.23261 WP_003901220.1.23272 WP_003901220.1.23289 WP_003901220.1.2329 WP_003901220.1.23308 WP_003901220.1.23325 WP_003901220.1.2339 WP_003901220.1.23406 WP_003901220.1.23438 WP_003901220.1.23452 WP_003901220.1.23461 WP_003901220.1.2349 WP_003901220.1.23496 WP_003901220.1.23506 WP_003901220.1.23530 WP_003901220.1.23546 WP_003901220.1.23551 WP_003901220.1.23583 WP_003901220.1.23588 WP_003901220.1.23628 WP_003901220.1.23677 WP_003901220.1.23683 WP_003901220.1.23692 WP_003901220.1.23694 WP_003901220.1.23699 WP_003901220.1.2371 WP_003901220.1.23803 WP_003901220.1.23807 WP_003901220.1.23832 WP_003901220.1.2384 WP_003901220.1.23843 WP_003901220.1.23863 WP_003901220.1.23993 WP_003901220.1.2400 WP_003901220.1.24057 WP_003901220.1.24113 WP_003901220.1.24119 WP_003901220.1.24176 WP_003901220.1.24190 WP_003901220.1.24284 WP_003901220.1.24294 WP_003901220.1.24357 WP_003901220.1.24396 WP_003901220.1.24423 WP_003901220.1.24446 WP_003901220.1.24461 WP_003901220.1.24500 WP_003901220.1.24507 WP_003901220.1.24509 WP_003901220.1.24529 WP_003901220.1.24553 WP_003901220.1.24824 WP_003901220.1.24831 WP_003901220.1.24840 WP_003901220.1.24848 WP_003901220.1.24857 WP_003901220.1.2487 WP_003901220.1.24893 WP_003901220.1.24933 WP_003901220.1.24956 WP_003901220.1.24985 WP_003901220.1.2499 WP_003901220.1.25004 WP_003901220.1.2505 WP_003901220.1.25051 WP_003901220.1.2507 WP_003901220.1.25096 WP_003901220.1.25103 WP_003901220.1.25171 WP_003901220.1.25184 WP_003901220.1.25247 WP_003901220.1.25309 WP_003901220.1.25313 WP_003901220.1.25338 WP_003901220.1.25342 WP_003901220.1.25367 WP_003901220.1.25393 WP_003901220.1.25406 WP_003901220.1.25437 WP_003901220.1.25445 WP_003901220.1.25455 WP_003901220.1.25504 WP_003901220.1.25513 WP_003901220.1.25542 WP_003901220.1.25579 WP_003901220.1.25594 WP_003901220.1.25606 WP_003901220.1.25645 WP_003901220.1.2566 WP_003901220.1.25673 WP_003901220.1.25693 WP_003901220.1.25699 WP_003901220.1.25727 WP_003901220.1.25736 WP_003901220.1.25738 WP_003901220.1.25759 WP_003901220.1.2580 WP_003901220.1.25813 WP_003901220.1.25854 WP_003901220.1.25874 WP_003901220.1.25892 WP_003901220.1.25914 WP_003901220.1.2594 WP_003901220.1.25972 WP_003901220.1.26017 WP_003901220.1.26032 WP_003901220.1.26038 WP_003901220.1.26072 WP_003901220.1.26097 WP_003901220.1.26098 WP_003901220.1.26109 WP_003901220.1.26118 WP_003901220.1.2614 WP_003901220.1.26182 WP_003901220.1.26190 WP_003901220.1.2620 WP_003901220.1.26243 WP_003901220.1.26292 WP_003901220.1.26310 WP_003901220.1.26328 WP_003901220.1.26349 WP_003901220.1.26366 WP_003901220.1.26454 WP_003901220.1.26464 WP_003901220.1.2653 WP_003901220.1.26560 WP_003901220.1.26571 WP_003901220.1.2659 WP_003901220.1.26597 WP_003901220.1.26603 WP_003901220.1.26702 WP_003901220.1.26707 WP_003901220.1.26710 WP_003901220.1.26719 WP_003901220.1.26737 WP_003901220.1.26738 WP_003901220.1.26745 WP_003901220.1.26756 WP_003901220.1.2676 WP_003901220.1.2677 WP_003901220.1.26779 WP_003901220.1.26780 WP_003901220.1.26868 WP_003901220.1.26888 WP_003901220.1.26945 WP_003901220.1.26959 WP_003901220.1.26969 WP_003901220.1.26984 WP_003901220.1.26992 WP_003901220.1.27074 WP_003901220.1.27152 WP_003901220.1.27162 WP_003901220.1.27164 WP_003901220.1.27193 WP_003901220.1.27235 WP_003901220.1.27278 WP_003901220.1.27343 WP_003901220.1.27352 WP_003901220.1.27391 WP_003901220.1.27398 WP_003901220.1.27402 WP_003901220.1.27460 WP_003901220.1.2749 WP_003901220.1.27492 WP_003901220.1.27528 WP_003901220.1.27576 WP_003901220.1.27582 WP_003901220.1.27607 WP_003901220.1.2766 WP_003901220.1.277 WP_003901220.1.27724 WP_003901220.1.27750 WP_003901220.1.27771 WP_003901220.1.27779 WP_003901220.1.27795 WP_003901220.1.27819 WP_003901220.1.27962 WP_003901220.1.28053 WP_003901220.1.28092 WP_003901220.1.28106 WP_003901220.1.28131 WP_003901220.1.28142 WP_003901220.1.28159 WP_003901220.1.2816 WP_003901220.1.28161 WP_003901220.1.28192 WP_003901220.1.28202 WP_003901220.1.28241 WP_003901220.1.28251 WP_003901220.1.28255 WP_003901220.1.28276 WP_003901220.1.28331 WP_003901220.1.28367 WP_003901220.1.28378 WP_003901220.1.2842 WP_003901220.1.2847 WP_003901220.1.28471 WP_003901220.1.28473 WP_003901220.1.28493 WP_003901220.1.28497 WP_003901220.1.28530 WP_003901220.1.28545 WP_003901220.1.28561 WP_003901220.1.28567 WP_003901220.1.28585 WP_003901220.1.286 WP_003901220.1.28610 WP_003901220.1.28617 WP_003901220.1.28671 WP_003901220.1.28698 WP_003901220.1.28703 WP_003901220.1.28739 WP_003901220.1.28787 WP_003901220.1.28827 WP_003901220.1.28839 WP_003901220.1.28847 WP_003901220.1.28851 WP_003901220.1.28865 WP_003901220.1.28897 WP_003901220.1.28935 WP_003901220.1.28936 WP_003901220.1.28939 WP_003901220.1.28943 WP_003901220.1.28952 WP_003901220.1.28975 WP_003901220.1.2899 WP_003901220.1.28993 WP_003901220.1.29000 WP_003901220.1.2901 WP_003901220.1.29028 WP_003901220.1.29033 WP_003901220.1.29058 WP_003901220.1.29115 WP_003901220.1.2916 WP_003901220.1.29217 WP_003901220.1.29234 WP_003901220.1.29306 WP_003901220.1.29339 WP_003901220.1.29364 WP_003901220.1.29367 WP_003901220.1.2938 WP_003901220.1.29426 WP_003901220.1.2944 WP_003901220.1.29450 WP_003901220.1.29510 WP_003901220.1.29515 WP_003901220.1.29525 WP_003901220.1.29587 WP_003901220.1.2959 WP_003901220.1.29599 WP_003901220.1.29611 WP_003901220.1.29632 WP_003901220.1.29649 WP_003901220.1.2965 WP_003901220.1.2969 WP_003901220.1.29718 WP_003901220.1.29745 WP_003901220.1.29747 WP_003901220.1.29825 WP_003901220.1.29830 WP_003901220.1.29847 WP_003901220.1.29861 WP_003901220.1.29869 WP_003901220.1.29890 WP_003901220.1.29931 WP_003901220.1.29960 WP_003901220.1.30014 WP_003901220.1.30040 WP_003901220.1.30043 WP_003901220.1.30114 WP_003901220.1.30126 WP_003901220.1.30138 WP_003901220.1.30139 WP_003901220.1.30235 WP_003901220.1.30237 WP_003901220.1.30279 WP_003901220.1.30282 WP_003901220.1.30291 WP_003901220.1.30363 WP_003901220.1.30433 WP_003901220.1.30438 WP_003901220.1.30462 WP_003901220.1.30464 WP_003901220.1.3057 WP_003901220.1.30574 WP_003901220.1.30628 WP_003901220.1.30641 WP_003901220.1.30642 WP_003901220.1.30699 WP_003901220.1.30709 WP_003901220.1.30713 WP_003901220.1.30716 WP_003901220.1.30719 WP_003901220.1.30730 WP_003901220.1.30736 WP_003901220.1.30760 WP_003901220.1.30807 WP_003901220.1.30818 WP_003901220.1.30877 WP_003901220.1.30888 WP_003901220.1.30903 WP_003901220.1.30912 WP_003901220.1.30913 WP_003901220.1.30919 WP_003901220.1.30977 WP_003901220.1.31002 WP_003901220.1.3101 WP_003901220.1.31047 WP_003901220.1.31074 WP_003901220.1.31127 WP_003901220.1.31199 WP_003901220.1.31226 WP_003901220.1.31230 WP_003901220.1.31263 WP_003901220.1.31264 WP_003901220.1.31270 WP_003901220.1.31287 WP_003901220.1.31290 WP_003901220.1.31304 WP_003901220.1.31348 WP_003901220.1.31354 WP_003901220.1.31390 WP_003901220.1.31414 WP_003901220.1.31417 WP_003901220.1.3143 WP_003901220.1.31458 WP_003901220.1.31483 WP_003901220.1.3149 WP_003901220.1.31537 WP_003901220.1.31548 WP_003901220.1.31569 WP_003901220.1.316 WP_003901220.1.31666 WP_003901220.1.31693 WP_003901220.1.31703 WP_003901220.1.31744 WP_003901220.1.31745 WP_003901220.1.31770 WP_003901220.1.3184 WP_003901220.1.31840 WP_003901220.1.31880 WP_003901220.1.31911 WP_003901220.1.31930 WP_003901220.1.31932 WP_003901220.1.31955 WP_003901220.1.31985 WP_003901220.1.31995 WP_003901220.1.32004 WP_003901220.1.3204 WP_003901220.1.32045 WP_003901220.1.32071 WP_003901220.1.32098 WP_003901220.1.32132 WP_003901220.1.32157 WP_003901220.1.32164 WP_003901220.1.32179 WP_003901220.1.32198 WP_003901220.1.32297 WP_003901220.1.32317 WP_003901220.1.32383 WP_003901220.1.32403 WP_003901220.1.32421 WP_003901220.1.32433 WP_003901220.1.32482 WP_003901220.1.32556 WP_003901220.1.32562 WP_003901220.1.32569 WP_003901220.1.32592 WP_003901220.1.32620 WP_003901220.1.32647 WP_003901220.1.32653 WP_003901220.1.32654 WP_003901220.1.3268 WP_003901220.1.32706 WP_003901220.1.32738 WP_003901220.1.32780 WP_003901220.1.32799 WP_003901220.1.32862 WP_003901220.1.32880 WP_003901220.1.32935 WP_003901220.1.32974 WP_003901220.1.33007 WP_003901220.1.33044 WP_003901220.1.33054 WP_003901220.1.33082 WP_003901220.1.33141 WP_003901220.1.33148 WP_003901220.1.33155 WP_003901220.1.3321 WP_003901220.1.3325 WP_003901220.1.3327 WP_003901220.1.33278 WP_003901220.1.33288 WP_003901220.1.33305 WP_003901220.1.33319 WP_003901220.1.3333 WP_003901220.1.33393 WP_003901220.1.33403 WP_003901220.1.33452 WP_003901220.1.33467 WP_003901220.1.33477 WP_003901220.1.3349 WP_003901220.1.33519 WP_003901220.1.33542 WP_003901220.1.33601 WP_003901220.1.33602 WP_003901220.1.33633 WP_003901220.1.33673 WP_003901220.1.3369 WP_003901220.1.33705 WP_003901220.1.33762 WP_003901220.1.33783 WP_003901220.1.33848 WP_003901220.1.3387 WP_003901220.1.33886 WP_003901220.1.33895 WP_003901220.1.33912 WP_003901220.1.34042 WP_003901220.1.3405 WP_003901220.1.34055 WP_003901220.1.34056 WP_003901220.1.34090 WP_003901220.1.34109 WP_003901220.1.34152 WP_003901220.1.34163 WP_003901220.1.34181 WP_003901220.1.34197 WP_003901220.1.34198 WP_003901220.1.34215 WP_003901220.1.34255 WP_003901220.1.34260 WP_003901220.1.343 WP_003901220.1.34347 WP_003901220.1.34392 WP_003901220.1.34428 WP_003901220.1.3443 WP_003901220.1.34435 WP_003901220.1.34446 WP_003901220.1.34499 WP_003901220.1.34516 WP_003901220.1.34563 WP_003901220.1.34576 WP_003901220.1.34581 WP_003901220.1.34588 WP_003901220.1.34596 WP_003901220.1.34599 WP_003901220.1.34724 WP_003901220.1.34740 WP_003901220.1.34755 WP_003901220.1.34777 WP_003901220.1.34783 WP_003901220.1.34841 WP_003901220.1.34908 WP_003901220.1.34919 WP_003901220.1.3492 WP_003901220.1.34945 WP_003901220.1.34946 WP_003901220.1.34961 WP_003901220.1.34963 WP_003901220.1.34965 WP_003901220.1.34968 WP_003901220.1.35069 WP_003901220.1.35160 WP_003901220.1.35176 WP_003901220.1.3520 WP_003901220.1.35213 WP_003901220.1.35221 WP_003901220.1.35246 WP_003901220.1.35278 WP_003901220.1.35301 WP_003901220.1.35311 WP_003901220.1.35317 WP_003901220.1.35319 WP_003901220.1.35347 WP_003901220.1.35363 WP_003901220.1.35382 WP_003901220.1.35385 WP_003901220.1.35396 WP_003901220.1.35397 WP_003901220.1.35426 WP_003901220.1.35439 WP_003901220.1.35455 WP_003901220.1.3548 WP_003901220.1.35484 WP_003901220.1.3553 WP_003901220.1.35553 WP_003901220.1.35555 WP_003901220.1.35561 WP_003901220.1.35635 WP_003901220.1.35657 WP_003901220.1.35687 WP_003901220.1.35689 WP_003901220.1.35707 WP_003901220.1.35732 WP_003901220.1.35754 WP_003901220.1.35767 WP_003901220.1.35771 WP_003901220.1.35780 WP_003901220.1.35805 WP_003901220.1.35848 WP_003901220.1.35864 WP_003901220.1.35874 WP_003901220.1.35876 WP_003901220.1.35899 WP_003901220.1.35954 WP_003901220.1.36005 WP_003901220.1.36014 WP_003901220.1.36051 WP_003901220.1.36053 WP_003901220.1.36075 WP_003901220.1.36097 WP_003901220.1.36098 WP_003901220.1.36116 WP_003901220.1.36145 WP_003901220.1.36205 WP_003901220.1.36228 WP_003901220.1.36271 WP_003901220.1.36309 WP_003901220.1.36315 WP_003901220.1.36319 WP_003901220.1.36321 WP_003901220.1.36326 WP_003901220.1.36356 WP_003901220.1.36357 WP_003901220.1.36385 WP_003901220.1.36399 WP_003901220.1.36436 WP_003901220.1.36469 WP_003901220.1.36508 WP_003901220.1.36540 WP_003901220.1.36571 WP_003901220.1.36578 WP_003901220.1.36585 WP_003901220.1.36597 WP_003901220.1.36614 WP_003901220.1.36674 WP_003901220.1.36720 WP_003901220.1.36727 WP_003901220.1.36733 WP_003901220.1.36810 WP_003901220.1.36862 WP_003901220.1.36893 WP_003901220.1.36901 WP_003901220.1.36921 WP_003901220.1.36935 WP_003901220.1.36941 WP_003901220.1.3695 WP_003901220.1.36968 WP_003901220.1.3700 WP_003901220.1.37071 WP_003901220.1.37131 WP_003901220.1.37157 WP_003901220.1.37175 WP_003901220.1.37229 WP_003901220.1.3724 WP_003901220.1.37305 WP_003901220.1.37389 WP_003901220.1.37400 WP_003901220.1.37440 WP_003901220.1.37459 WP_003901220.1.37475 WP_003901220.1.37484 WP_003901220.1.37601 WP_003901220.1.37612 WP_003901220.1.37643 WP_003901220.1.37655 WP_003901220.1.37660 WP_003901220.1.37700 WP_003901220.1.37701 WP_003901220.1.37709 WP_003901220.1.37721 WP_003901220.1.37722 WP_003901220.1.37747 WP_003901220.1.37804 WP_003901220.1.37809 WP_003901220.1.37859 WP_003901220.1.37877 WP_003901220.1.37912 WP_003901220.1.37913 WP_003901220.1.37943 WP_003901220.1.37973 WP_003901220.1.37975 WP_003901220.1.38 WP_003901220.1.38002 WP_003901220.1.3802 WP_003901220.1.38039 WP_003901220.1.38040 WP_003901220.1.38067 WP_003901220.1.38068 WP_003901220.1.38138 WP_003901220.1.38158 WP_003901220.1.38159 WP_003901220.1.38210 WP_003901220.1.38233 WP_003901220.1.38240 WP_003901220.1.38332 WP_003901220.1.38354 WP_003901220.1.38398 WP_003901220.1.38402 WP_003901220.1.38418 WP_003901220.1.38421 WP_003901220.1.38466 WP_003901220.1.38477 WP_003901220.1.38483 WP_003901220.1.3849 WP_003901220.1.385 WP_003901220.1.38530 WP_003901220.1.38594 WP_003901220.1.38611 WP_003901220.1.38639 WP_003901220.1.38654 WP_003901220.1.38660 WP_003901220.1.38666 WP_003901220.1.38672 WP_003901220.1.38677 WP_003901220.1.38772 WP_003901220.1.38821 WP_003901220.1.38844 WP_003901220.1.38863 WP_003901220.1.38873 WP_003901220.1.3889 WP_003901220.1.38894 WP_003901220.1.38939 WP_003901220.1.38974 WP_003901220.1.38975 WP_003901220.1.38991 WP_003901220.1.39025 WP_003901220.1.39070 WP_003901220.1.39072 WP_003901220.1.39095 WP_003901220.1.39106 WP_003901220.1.39165 WP_003901220.1.39174 WP_003901220.1.39176 WP_003901220.1.39178 WP_003901220.1.39190 WP_003901220.1.39201 WP_003901220.1.39236 WP_003901220.1.39239 WP_003901220.1.39252 WP_003901220.1.39288 WP_003901220.1.39295 WP_003901220.1.39306 WP_003901220.1.39400 WP_003901220.1.39447 WP_003901220.1.3945 WP_003901220.1.39450 WP_003901220.1.39455 WP_003901220.1.39521 WP_003901220.1.39593 WP_003901220.1.3960 WP_003901220.1.39616 WP_003901220.1.39654 WP_003901220.1.39661 WP_003901220.1.39674 WP_003901220.1.39678 WP_003901220.1.3968 WP_003901220.1.39694 WP_003901220.1.39718 WP_003901220.1.39728 WP_003901220.1.39739 WP_003901220.1.39751 WP_003901220.1.39759 WP_003901220.1.39801 WP_003901220.1.39804 WP_003901220.1.39848 WP_003901220.1.39877 WP_003901220.1.39925 WP_003901220.1.3994 WP_003901220.1.39959 WP_003901220.1.3996 WP_003901220.1.39960 WP_003901220.1.3997 WP_003901220.1.40000 WP_003901220.1.4003 WP_003901220.1.40094 WP_003901220.1.40096 WP_003901220.1.40150 WP_003901220.1.40174 WP_003901220.1.40186 WP_003901220.1.40276 WP_003901220.1.40277 WP_003901220.1.40323 WP_003901220.1.40336 WP_003901220.1.4036 WP_003901220.1.40372 WP_003901220.1.40402 WP_003901220.1.40413 WP_003901220.1.40451 WP_003901220.1.40455 WP_003901220.1.40523 WP_003901220.1.40641 WP_003901220.1.40646 WP_003901220.1.40651 WP_003901220.1.40653 WP_003901220.1.4067 WP_003901220.1.40705 WP_003901220.1.40723 WP_003901220.1.40731 WP_003901220.1.40735 WP_003901220.1.40795 WP_003901220.1.40799 WP_003901220.1.40876 WP_003901220.1.40881 WP_003901220.1.40922 WP_003901220.1.4095 WP_003901220.1.40957 WP_003901220.1.410 WP_003901220.1.41000 WP_003901220.1.41055 WP_003901220.1.41108 WP_003901220.1.41177 WP_003901220.1.41219 WP_003901220.1.41231 WP_003901220.1.41249 WP_003901220.1.4127 WP_003901220.1.41355 WP_003901220.1.41469 WP_003901220.1.41504 WP_003901220.1.41553 WP_003901220.1.41564 WP_003901220.1.41632 WP_003901220.1.41635 WP_003901220.1.41636 WP_003901220.1.41660 WP_003901220.1.41685 WP_003901220.1.41695 WP_003901220.1.41704 WP_003901220.1.4171 WP_003901220.1.41719 WP_003901220.1.41744 WP_003901220.1.41791 WP_003901220.1.41820 WP_003901220.1.41828 WP_003901220.1.41829 WP_003901220.1.41860 WP_003901220.1.41912 WP_003901220.1.41921 WP_003901220.1.41944 WP_003901220.1.42043 WP_003901220.1.42122 WP_003901220.1.42134 WP_003901220.1.42208 WP_003901220.1.42247 WP_003901220.1.42255 WP_003901220.1.42273 WP_003901220.1.42278 WP_003901220.1.42385 WP_003901220.1.42400 WP_003901220.1.42430 WP_003901220.1.42467 WP_003901220.1.42473 WP_003901220.1.42474 WP_003901220.1.4248 WP_003901220.1.42494 WP_003901220.1.42519 WP_003901220.1.42524 WP_003901220.1.42534 WP_003901220.1.4255 WP_003901220.1.42562 WP_003901220.1.42568 WP_003901220.1.42570 WP_003901220.1.42618 WP_003901220.1.42660 WP_003901220.1.42695 WP_003901220.1.42704 WP_003901220.1.42705 WP_003901220.1.42722 WP_003901220.1.42782 WP_003901220.1.42835 WP_003901220.1.42839 WP_003901220.1.42842 WP_003901220.1.42905 WP_003901220.1.42971 WP_003901220.1.43009 WP_003901220.1.43053 WP_003901220.1.43082 WP_003901220.1.43087 WP_003901220.1.43208 WP_003901220.1.43236 WP_003901220.1.43246 WP_003901220.1.43255 WP_003901220.1.43266 WP_003901220.1.43269 WP_003901220.1.43273 WP_003901220.1.43296 WP_003901220.1.43306 WP_003901220.1.43368 WP_003901220.1.43457 WP_003901220.1.43462 WP_003901220.1.43475 WP_003901220.1.43643 WP_003901220.1.43664 WP_003901220.1.43706 WP_003901220.1.43716 WP_003901220.1.4377 WP_003901220.1.43815 WP_003901220.1.43861 WP_003901220.1.43863 WP_003901220.1.43866 WP_003901220.1.43872 WP_003901220.1.43885 WP_003901220.1.43897 WP_003901220.1.43902 WP_003901220.1.43921 WP_003901220.1.43937 WP_003901220.1.43960 WP_003901220.1.43965 WP_003901220.1.43993 WP_003901220.1.43996 WP_003901220.1.44 WP_003901220.1.44033 WP_003901220.1.44037 WP_003901220.1.44076 WP_003901220.1.44104 WP_003901220.1.44124 WP_003901220.1.44169 WP_003901220.1.44277 WP_003901220.1.44279 WP_003901220.1.44355 WP_003901220.1.44358 WP_003901220.1.44390 WP_003901220.1.4441 WP_003901220.1.44415 WP_003901220.1.44466 WP_003901220.1.44489 WP_003901220.1.44492 WP_003901220.1.44494 WP_003901220.1.44500 WP_003901220.1.44532 WP_003901220.1.44534 WP_003901220.1.44562 WP_003901220.1.44600 WP_003901220.1.44602 WP_003901220.1.4464 WP_003901220.1.44651 WP_003901220.1.44659 WP_003901220.1.44665 WP_003901220.1.44694 WP_003901220.1.44713 WP_003901220.1.44735 WP_003901220.1.44757 WP_003901220.1.4476 WP_003901220.1.44761 WP_003901220.1.44776 WP_003901220.1.44779 WP_003901220.1.44786 WP_003901220.1.44808 WP_003901220.1.44908 WP_003901220.1.4492 WP_003901220.1.44939 WP_003901220.1.44979 WP_003901220.1.44981 WP_003901220.1.45002 WP_003901220.1.45011 WP_003901220.1.45081 WP_003901220.1.45113 WP_003901220.1.45129 WP_003901220.1.45147 WP_003901220.1.45168 WP_003901220.1.4517 WP_003901220.1.45181 WP_003901220.1.45185 WP_003901220.1.45200 WP_003901220.1.45205 WP_003901220.1.45211 WP_003901220.1.45249 WP_003901220.1.4526 WP_003901220.1.45326 WP_003901220.1.45374 WP_003901220.1.45390 WP_003901220.1.454 WP_003901220.1.45407 WP_003901220.1.45451 WP_003901220.1.45453 WP_003901220.1.45460 WP_003901220.1.45463 WP_003901220.1.45474 WP_003901220.1.45491 WP_003901220.1.45510 WP_003901220.1.45563 WP_003901220.1.45584 WP_003901220.1.45590 WP_003901220.1.45619 WP_003901220.1.45626 WP_003901220.1.45697 WP_003901220.1.4571 WP_003901220.1.45731 WP_003901220.1.45743 WP_003901220.1.45765 WP_003901220.1.45776 WP_003901220.1.45805 WP_003901220.1.45849 WP_003901220.1.45867 WP_003901220.1.4590 WP_003901220.1.45923 WP_003901220.1.45926 WP_003901220.1.45963 WP_003901220.1.45992 WP_003901220.1.46025 WP_003901220.1.46083 WP_003901220.1.46090 WP_003901220.1.46092 WP_003901220.1.46100 WP_003901220.1.46101 WP_003901220.1.46103 WP_003901220.1.46107 WP_003901220.1.46127 WP_003901220.1.46128 WP_003901220.1.46129 WP_003901220.1.46141 WP_003901220.1.46201 WP_003901220.1.46226 WP_003901220.1.4624 WP_003901220.1.46268 WP_003901220.1.46300 WP_003901220.1.46313 WP_003901220.1.46336 WP_003901220.1.46411 WP_003901220.1.4644 WP_003901220.1.46442 WP_003901220.1.46453 WP_003901220.1.46478 WP_003901220.1.46492 WP_003901220.1.46521 WP_003901220.1.46532 WP_003901220.1.46568 WP_003901220.1.46585 WP_003901220.1.46609 WP_003901220.1.46613 WP_003901220.1.46625 WP_003901220.1.46642 WP_003901220.1.46647 WP_003901220.1.46724 WP_003901220.1.46773 WP_003901220.1.46777 WP_003901220.1.46786 WP_003901220.1.46792 WP_003901220.1.46847 WP_003901220.1.4687 WP_003901220.1.46936 WP_003901220.1.46980 WP_003901220.1.47011 WP_003901220.1.47066 WP_003901220.1.47077 WP_003901220.1.47083 WP_003901220.1.47106 WP_003901220.1.47142 WP_003901220.1.47147 WP_003901220.1.47166 WP_003901220.1.47178 WP_003901220.1.47179 WP_003901220.1.47194 WP_003901220.1.47207 WP_003901220.1.47210 WP_003901220.1.47261 WP_003901220.1.47262 WP_003901220.1.47402 WP_003901220.1.47423 WP_003901220.1.47467 WP_003901220.1.47502 WP_003901220.1.47511 WP_003901220.1.47537 WP_003901220.1.47540 WP_003901220.1.47572 WP_003901220.1.47588 WP_003901220.1.47636 WP_003901220.1.4764 WP_003901220.1.47679 WP_003901220.1.47690 WP_003901220.1.47754 WP_003901220.1.47773 WP_003901220.1.47776 WP_003901220.1.47780 WP_003901220.1.47805 WP_003901220.1.47832 WP_003901220.1.47858 WP_003901220.1.47861 WP_003901220.1.47868 WP_003901220.1.47899 WP_003901220.1.479 WP_003901220.1.47912 WP_003901220.1.47913 WP_003901220.1.47926 WP_003901220.1.47944 WP_003901220.1.47959 WP_003901220.1.47974 WP_003901220.1.47993 WP_003901220.1.48004 WP_003901220.1.48097 WP_003901220.1.48101 WP_003901220.1.4813 WP_003901220.1.48130 WP_003901220.1.48135 WP_003901220.1.48143 WP_003901220.1.48155 WP_003901220.1.48170 WP_003901220.1.48177 WP_003901220.1.48185 WP_003901220.1.48204 WP_003901220.1.48240 WP_003901220.1.48256 WP_003901220.1.48264 WP_003901220.1.48287 WP_003901220.1.48333 WP_003901220.1.48372 WP_003901220.1.48383 WP_003901220.1.48419 WP_003901220.1.48443 WP_003901220.1.48543 WP_003901220.1.48605 WP_003901220.1.48618 WP_003901220.1.4863 WP_003901220.1.48648 WP_003901220.1.48658 WP_003901220.1.48687 WP_003901220.1.48779 WP_003901220.1.4878 WP_003901220.1.48802 WP_003901220.1.48826 WP_003901220.1.48831 WP_003901220.1.4890 WP_003901220.1.48946 WP_003901220.1.49048 WP_003901220.1.49059 WP_003901220.1.4907 WP_003901220.1.49103 WP_003901220.1.49110 WP_003901220.1.49112 WP_003901220.1.4919 WP_003901220.1.49251 WP_003901220.1.49254 WP_003901220.1.49263 WP_003901220.1.49291 WP_003901220.1.49296 WP_003901220.1.49335 WP_003901220.1.49337 WP_003901220.1.49426 WP_003901220.1.49437 WP_003901220.1.49439 WP_003901220.1.49474 WP_003901220.1.49506 WP_003901220.1.49523 WP_003901220.1.49526 WP_003901220.1.49532 WP_003901220.1.4959 WP_003901220.1.49687 WP_003901220.1.49699 WP_003901220.1.49736 WP_003901220.1.49746 WP_003901220.1.49764 WP_003901220.1.49773 WP_003901220.1.49796 WP_003901220.1.49814 WP_003901220.1.49815 WP_003901220.1.49816 WP_003901220.1.49857 WP_003901220.1.49878 WP_003901220.1.4999 WP_003901220.1.49990 WP_003901220.1.50068 WP_003901220.1.50077 WP_003901220.1.5008 WP_003901220.1.50081 WP_003901220.1.50122 WP_003901220.1.50126 WP_003901220.1.50162 WP_003901220.1.5018 WP_003901220.1.50194 WP_003901220.1.50218 WP_003901220.1.50235 WP_003901220.1.50249 WP_003901220.1.50265 WP_003901220.1.50271 WP_003901220.1.50347 WP_003901220.1.50398 WP_003901220.1.50466 WP_003901220.1.50472 WP_003901220.1.5048 WP_003901220.1.50498 WP_003901220.1.5050 WP_003901220.1.50540 WP_003901220.1.50554 WP_003901220.1.50557 WP_003901220.1.50601 WP_003901220.1.50610 WP_003901220.1.50632 WP_003901220.1.50655 WP_003901220.1.50659 WP_003901220.1.50683 WP_003901220.1.50689 WP_003901220.1.50692 WP_003901220.1.50714 WP_003901220.1.50756 WP_003901220.1.50784 WP_003901220.1.50794 WP_003901220.1.50877 WP_003901220.1.5096 WP_003901220.1.51003 WP_003901220.1.51009 WP_003901220.1.51037 WP_003901220.1.51074 WP_003901220.1.51101 WP_003901220.1.51232 WP_003901220.1.51239 WP_003901220.1.51247 WP_003901220.1.51266 WP_003901220.1.51329 WP_003901220.1.51391 WP_003901220.1.51422 WP_003901220.1.51445 WP_003901220.1.51455 WP_003901220.1.51466 WP_003901220.1.51468 WP_003901220.1.51478 WP_003901220.1.51497 WP_003901220.1.51520 WP_003901220.1.51593 WP_003901220.1.5164 WP_003901220.1.51647 WP_003901220.1.51660 WP_003901220.1.51696 WP_003901220.1.51721 WP_003901220.1.51788 WP_003901220.1.51795 WP_003901220.1.51801 WP_003901220.1.51817 WP_003901220.1.51923 WP_003901220.1.51942 WP_003901220.1.51963 WP_003901220.1.51969 WP_003901220.1.52000 WP_003901220.1.52001 WP_003901220.1.52003 WP_003901220.1.52006 WP_003901220.1.52046 WP_003901220.1.52059 WP_003901220.1.52082 WP_003901220.1.52102 WP_003901220.1.52166 WP_003901220.1.52178 WP_003901220.1.52206 WP_003901220.1.52216 WP_003901220.1.52280 WP_003901220.1.52314 WP_003901220.1.52385 WP_003901220.1.52390 WP_003901220.1.524 WP_003901220.1.52460 WP_003901220.1.52485 WP_003901220.1.52486 WP_003901220.1.52504 WP_003901220.1.52522 WP_003901220.1.52531 WP_003901220.1.52533 WP_003901220.1.52545 WP_003901220.1.52553 WP_003901220.1.52563 WP_003901220.1.52574 WP_003901220.1.52641 WP_003901220.1.52674 WP_003901220.1.52708 WP_003901220.1.52761 WP_003901220.1.52778 WP_003901220.1.52797 WP_003901220.1.52818 WP_003901220.1.52872 WP_003901220.1.52873 WP_003901220.1.52891 WP_003901220.1.52892 WP_003901220.1.52909 WP_003901220.1.52998 WP_003901220.1.53053 WP_003901220.1.53056 WP_003901220.1.5306 WP_003901220.1.53088 WP_003901220.1.5309 WP_003901220.1.531 WP_003901220.1.53142 WP_003901220.1.53143 WP_003901220.1.53157 WP_003901220.1.53167 WP_003901220.1.53213 WP_003901220.1.53217 WP_003901220.1.53229 WP_003901220.1.53230 WP_003901220.1.53237 WP_003901220.1.53254 WP_003901220.1.53257 WP_003901220.1.5327 WP_003901220.1.53276 WP_003901220.1.53278 WP_003901220.1.533 WP_003901220.1.5334 WP_003901220.1.53353 WP_003901220.1.53381 WP_003901220.1.53460 WP_003901220.1.53480 WP_003901220.1.53517 WP_003901220.1.53522 WP_003901220.1.53525 WP_003901220.1.53526 WP_003901220.1.53553 WP_003901220.1.53606 WP_003901220.1.53628 WP_003901220.1.53679 WP_003901220.1.53730 WP_003901220.1.53754 WP_003901220.1.53775 WP_003901220.1.53803 WP_003901220.1.53818 WP_003901220.1.53853 WP_003901220.1.53865 WP_003901220.1.53888 WP_003901220.1.53912 WP_003901220.1.53914 WP_003901220.1.53952 WP_003901220.1.54089 WP_003901220.1.54099 WP_003901220.1.54112 WP_003901220.1.54125 WP_003901220.1.54162 WP_003901220.1.54179 WP_003901220.1.54218 WP_003901220.1.54225 WP_003901220.1.54227 WP_003901220.1.54232 WP_003901220.1.54241 WP_003901220.1.54245 WP_003901220.1.54260 WP_003901220.1.54275 WP_003901220.1.5429 WP_003901220.1.54314 WP_003901220.1.54351 WP_003901220.1.54370 WP_003901220.1.54428 WP_003901220.1.54494 WP_003901220.1.54519 WP_003901220.1.54531 WP_003901220.1.54537 WP_003901220.1.54553 WP_003901220.1.54555 WP_003901220.1.54633 WP_003901220.1.54705 WP_003901220.1.54730 WP_003901220.1.54732 WP_003901220.1.5475 WP_003901220.1.54797 WP_003901220.1.54836 WP_003901220.1.54838 WP_003901220.1.54860 WP_003901220.1.54888 WP_003901220.1.54897 WP_003901220.1.54905 WP_003901220.1.54909 WP_003901220.1.54937 WP_003901220.1.54944 WP_003901220.1.54945 WP_003901220.1.54953 WP_003901220.1.54964 WP_003901220.1.55022 WP_003901220.1.55023 WP_003901220.1.55051 WP_003901220.1.55088 WP_003901220.1.55106 WP_003901220.1.55126 WP_003901220.1.55128 WP_003901220.1.55140 WP_003901220.1.55210 WP_003901220.1.55227 WP_003901220.1.55248 WP_003901220.1.55257 WP_003901220.1.55258 WP_003901220.1.55267 WP_003901220.1.55307 WP_003901220.1.55326 WP_003901220.1.55328 WP_003901220.1.55345 WP_003901220.1.55396 WP_003901220.1.55398 WP_003901220.1.55441 WP_003901220.1.55501 WP_003901220.1.55578 WP_003901220.1.55626 WP_003901220.1.55723 WP_003901220.1.55735 WP_003901220.1.5574 WP_003901220.1.55772 WP_003901220.1.55819 WP_003901220.1.55821 WP_003901220.1.5583 WP_003901220.1.55849 WP_003901220.1.55856 WP_003901220.1.55860 WP_003901220.1.55882 WP_003901220.1.55883 WP_003901220.1.55894 WP_003901220.1.55902 WP_003901220.1.55909 WP_003901220.1.5591 WP_003901220.1.55961 WP_003901220.1.55977 WP_003901220.1.55983 WP_003901220.1.56028 WP_003901220.1.56060 WP_003901220.1.56107 WP_003901220.1.56132 WP_003901220.1.56163 WP_003901220.1.56167 WP_003901220.1.56287 WP_003901220.1.56292 WP_003901220.1.56341 WP_003901220.1.56359 WP_003901220.1.56365 WP_003901220.1.56478 WP_003901220.1.56500 WP_003901220.1.5656 WP_003901220.1.56577 WP_003901220.1.56625 WP_003901220.1.56670 WP_003901220.1.567 WP_003901220.1.56701 WP_003901220.1.56743 WP_003901220.1.56755 WP_003901220.1.56764 WP_003901220.1.5681 WP_003901220.1.56827 WP_003901220.1.56863 WP_003901220.1.56869 WP_003901220.1.56926 WP_003901220.1.56961 WP_003901220.1.56972 WP_003901220.1.57023 WP_003901220.1.57035 WP_003901220.1.57077 WP_003901220.1.57087 WP_003901220.1.57134 WP_003901220.1.57169 WP_003901220.1.57208 WP_003901220.1.57212 WP_003901220.1.57230 WP_003901220.1.5724 WP_003901220.1.57273 WP_003901220.1.57326 WP_003901220.1.57328 WP_003901220.1.57331 WP_003901220.1.57340 WP_003901220.1.57380 WP_003901220.1.57430 WP_003901220.1.57440 WP_003901220.1.5745 WP_003901220.1.57461 WP_003901220.1.57489 WP_003901220.1.575 WP_003901220.1.57519 WP_003901220.1.57596 WP_003901220.1.57619 WP_003901220.1.57627 WP_003901220.1.57642 WP_003901220.1.57658 WP_003901220.1.57667 WP_003901220.1.57675 WP_003901220.1.57708 WP_003901220.1.57825 WP_003901220.1.57906 WP_003901220.1.57924 WP_003901220.1.57926 WP_003901220.1.57957 WP_003901220.1.57960 WP_003901220.1.57991 WP_003901220.1.58086 WP_003901220.1.58103 WP_003901220.1.5811 WP_003901220.1.58121 WP_003901220.1.58145 WP_003901220.1.58174 WP_003901220.1.58209 WP_003901220.1.5824 WP_003901220.1.58259 WP_003901220.1.58288 WP_003901220.1.58303 WP_003901220.1.58330 WP_003901220.1.58359 WP_003901220.1.58386 WP_003901220.1.58393 WP_003901220.1.58431 WP_003901220.1.5844 WP_003901220.1.58457 WP_003901220.1.58488 WP_003901220.1.58518 WP_003901220.1.58559 WP_003901220.1.58567 WP_003901220.1.58573 WP_003901220.1.58602 WP_003901220.1.58612 WP_003901220.1.58619 WP_003901220.1.58630 WP_003901220.1.5865 WP_003901220.1.58671 WP_003901220.1.58690 WP_003901220.1.58743 WP_003901220.1.58754 WP_003901220.1.5879 WP_003901220.1.5881 WP_003901220.1.58824 WP_003901220.1.58848 WP_003901220.1.58857 WP_003901220.1.5890 WP_003901220.1.58904 WP_003901220.1.58921 WP_003901220.1.58930 WP_003901220.1.58953 WP_003901220.1.58961 WP_003901220.1.59085 WP_003901220.1.59112 WP_003901220.1.5914 WP_003901220.1.59147 WP_003901220.1.59166 WP_003901220.1.59205 WP_003901220.1.59237 WP_003901220.1.59253 WP_003901220.1.59254 WP_003901220.1.59270 WP_003901220.1.5928 WP_003901220.1.59305 WP_003901220.1.59309 WP_003901220.1.59328 WP_003901220.1.59333 WP_003901220.1.59428 WP_003901220.1.59487 WP_003901220.1.59561 WP_003901220.1.59677 WP_003901220.1.59722 WP_003901220.1.59727 WP_003901220.1.59732 WP_003901220.1.59750 WP_003901220.1.59757 WP_003901220.1.59860 WP_003901220.1.59861 WP_003901220.1.5987 WP_003901220.1.59878 WP_003901220.1.59888 WP_003901220.1.5996 WP_003901220.1.59961 WP_003901220.1.59974 WP_003901220.1.6000 WP_003901220.1.60047 WP_003901220.1.6007 WP_003901220.1.60125 WP_003901220.1.60139 WP_003901220.1.60152 WP_003901220.1.60171 WP_003901220.1.60197 WP_003901220.1.6020 WP_003901220.1.60217 WP_003901220.1.60267 WP_003901220.1.60305 WP_003901220.1.60312 WP_003901220.1.60313 WP_003901220.1.60314 WP_003901220.1.60367 WP_003901220.1.60376 WP_003901220.1.60403 WP_003901220.1.60413 WP_003901220.1.60421 WP_003901220.1.60512 WP_003901220.1.60573 WP_003901220.1.60632 WP_003901220.1.60657 WP_003901220.1.60689 WP_003901220.1.60727 WP_003901220.1.60738 WP_003901220.1.60763 WP_003901220.1.6077 WP_003901220.1.60791 WP_003901220.1.60834 WP_003901220.1.60878 WP_003901220.1.60879 WP_003901220.1.60913 WP_003901220.1.60978 WP_003901220.1.61000 WP_003901220.1.61001 WP_003901220.1.61012 WP_003901220.1.61014 WP_003901220.1.61015 WP_003901220.1.61037 WP_003901220.1.61052 WP_003901220.1.61065 WP_003901220.1.61100 WP_003901220.1.61138 WP_003901220.1.61142 WP_003901220.1.61198 WP_003901220.1.61314 WP_003901220.1.61321 WP_003901220.1.61326 WP_003901220.1.61328 WP_003901220.1.61368 WP_003901220.1.61391 WP_003901220.1.61406 WP_003901220.1.61409 WP_003901220.1.61422 WP_003901220.1.61425 WP_003901220.1.61428 WP_003901220.1.61469 WP_003901220.1.61522 WP_003901220.1.61552 WP_003901220.1.61557 WP_003901220.1.61567 WP_003901220.1.61571 WP_003901220.1.61573 WP_003901220.1.61584 WP_003901220.1.61586 WP_003901220.1.6159 WP_003901220.1.61592 WP_003901220.1.6163 WP_003901220.1.61655 WP_003901220.1.61665 WP_003901220.1.61669 WP_003901220.1.61682 WP_003901220.1.61719 WP_003901220.1.61728 WP_003901220.1.61750 WP_003901220.1.61754 WP_003901220.1.61757 WP_003901220.1.6179 WP_003901220.1.61842 WP_003901220.1.61850 WP_003901220.1.61862 WP_003901220.1.61865 WP_003901220.1.61868 WP_003901220.1.61953 WP_003901220.1.61986 WP_003901220.1.61987 WP_003901220.1.62021 WP_003901220.1.62087 WP_003901220.1.62101 WP_003901220.1.6211 WP_003901220.1.62132 WP_003901220.1.62162 WP_003901220.1.62225 WP_003901220.1.62230 WP_003901220.1.62238 WP_003901220.1.62249 WP_003901220.1.62281 WP_003901220.1.62307 WP_003901220.1.6231 WP_003901220.1.62359 WP_003901220.1.62449 WP_003901220.1.62468 WP_003901220.1.6248 WP_003901220.1.62565 WP_003901220.1.62594 WP_003901220.1.62606 WP_003901220.1.62666 WP_003901220.1.62687 WP_003901220.1.62730 WP_003901220.1.62761 WP_003901220.1.62766 WP_003901220.1.62813 WP_003901220.1.62841 WP_003901220.1.62909 WP_003901220.1.62936 WP_003901220.1.6294 WP_003901220.1.62962 WP_003901220.1.63007 WP_003901220.1.63019 WP_003901220.1.63037 WP_003901220.1.63066 WP_003901220.1.63072 WP_003901220.1.6308 WP_003901220.1.63106 WP_003901220.1.63144 WP_003901220.1.63160 WP_003901220.1.63161 WP_003901220.1.63194 WP_003901220.1.63222 WP_003901220.1.63291 WP_003901220.1.63312 WP_003901220.1.63317 WP_003901220.1.63331 WP_003901220.1.63384 WP_003901220.1.63403 WP_003901220.1.63424 WP_003901220.1.63428 WP_003901220.1.6345 WP_003901220.1.63464 WP_003901220.1.63483 WP_003901220.1.63502 WP_003901220.1.63504 WP_003901220.1.63522 WP_003901220.1.63567 WP_003901220.1.63596 WP_003901220.1.63600 WP_003901220.1.63623 WP_003901220.1.63624 WP_003901220.1.63625 WP_003901220.1.63627 WP_003901220.1.63662 WP_003901220.1.63711 WP_003901220.1.63734 WP_003901220.1.63807 WP_003901220.1.63819 WP_003901220.1.63844 WP_003901220.1.63888 WP_003901220.1.63913 WP_003901220.1.63915 WP_003901220.1.63961 WP_003901220.1.63970 WP_003901220.1.64000 WP_003901220.1.64058 WP_003901220.1.64065 WP_003901220.1.6407 WP_003901220.1.64082 WP_003901220.1.64102 WP_003901220.1.64104 WP_003901220.1.64219 WP_003901220.1.6422 WP_003901220.1.64235 WP_003901220.1.64249 WP_003901220.1.64278 WP_003901220.1.64287 WP_003901220.1.64414 WP_003901220.1.64419 WP_003901220.1.64480 WP_003901220.1.64497 WP_003901220.1.64511 WP_003901220.1.64515 WP_003901220.1.64522 WP_003901220.1.64526 WP_003901220.1.6456 WP_003901220.1.64567 WP_003901220.1.64588 WP_003901220.1.64589 WP_003901220.1.64594 WP_003901220.1.64595 WP_003901220.1.64608 WP_003901220.1.64619 WP_003901220.1.64629 WP_003901220.1.64664 WP_003901220.1.64680 WP_003901220.1.64682 WP_003901220.1.64727 WP_003901220.1.64776 WP_003901220.1.64832 WP_003901220.1.6486 WP_003901220.1.64870 WP_003901220.1.64898 WP_003901220.1.64922 WP_003901220.1.64924 WP_003901220.1.64973 WP_003901220.1.65001 WP_003901220.1.65026 WP_003901220.1.65053 WP_003901220.1.65070 WP_003901220.1.65079 WP_003901220.1.65102 WP_003901220.1.65157 WP_003901220.1.6523 WP_003901220.1.65253 WP_003901220.1.65289 WP_003901220.1.65291 WP_003901220.1.65315 WP_003901220.1.65359 WP_003901220.1.6536 WP_003901220.1.65414 WP_003901220.1.65416 WP_003901220.1.65455 WP_003901220.1.65467 WP_003901220.1.65488 WP_003901220.1.65529 WP_003901220.1.65539 WP_003901220.1.65612 WP_003901220.1.65635 WP_003901220.1.65637 WP_003901220.1.65648 WP_003901220.1.65686 WP_003901220.1.65688 WP_003901220.1.65733 WP_003901220.1.65746 WP_003901220.1.65747 WP_003901220.1.65759 WP_003901220.1.65816 WP_003901220.1.65830 WP_003901220.1.65858 WP_003901220.1.65862 WP_003901220.1.65869 WP_003901220.1.65893 WP_003901220.1.65929 WP_003901220.1.65932 WP_003901220.1.65958 WP_003901220.1.65974 WP_003901220.1.66004 WP_003901220.1.6606 WP_003901220.1.66149 WP_003901220.1.66151 WP_003901220.1.66323 WP_003901220.1.6633 WP_003901220.1.66334 WP_003901220.1.66367 WP_003901220.1.66394 WP_003901220.1.66396 WP_003901220.1.66451 WP_003901220.1.66455 WP_003901220.1.66457 WP_003901220.1.66464 WP_003901220.1.66466 WP_003901220.1.66504 WP_003901220.1.66544 WP_003901220.1.66558 WP_003901220.1.66580 WP_003901220.1.66582 WP_003901220.1.66612 WP_003901220.1.66617 WP_003901220.1.66635 WP_003901220.1.66656 WP_003901220.1.66675 WP_003901220.1.66715 WP_003901220.1.66762 WP_003901220.1.66776 WP_003901220.1.66808 WP_003901220.1.66817 WP_003901220.1.66819 WP_003901220.1.66826 WP_003901220.1.66830 WP_003901220.1.66842 WP_003901220.1.66878 WP_003901220.1.66880 WP_003901220.1.66893 WP_003901220.1.66961 WP_003901220.1.67005 WP_003901220.1.67044 WP_003901220.1.67089 WP_003901220.1.67098 WP_003901220.1.67146 WP_003901220.1.67197 WP_003901220.1.67198 WP_003901220.1.6720 WP_003901220.1.67207 WP_003901220.1.67218 WP_003901220.1.67225 WP_003901220.1.67231 WP_003901220.1.6724 WP_003901220.1.67257 WP_003901220.1.67298 WP_003901220.1.67324 WP_003901220.1.67381 WP_003901220.1.67417 WP_003901220.1.67453 WP_003901220.1.67482 WP_003901220.1.67496 WP_003901220.1.67499 WP_003901220.1.67523 WP_003901220.1.67536 WP_003901220.1.67575 WP_003901220.1.67587 WP_003901220.1.67602 WP_003901220.1.67679 WP_003901220.1.67692 WP_003901220.1.67744 WP_003901220.1.6775 WP_003901220.1.67809 WP_003901220.1.67816 WP_003901220.1.67844 WP_003901220.1.67848 WP_003901220.1.67888 WP_003901220.1.67945 WP_003901220.1.67949 WP_003901220.1.67980 WP_003901220.1.67982 WP_003901220.1.68022 WP_003901220.1.68029 WP_003901220.1.68037 WP_003901220.1.68038 WP_003901220.1.68045 WP_003901220.1.68057 WP_003901220.1.68083 WP_003901220.1.68088 WP_003901220.1.68106 WP_003901220.1.68110 WP_003901220.1.68212 WP_003901220.1.68243 WP_003901220.1.6825 WP_003901220.1.68297 WP_003901220.1.68309 WP_003901220.1.68325 WP_003901220.1.68329 WP_003901220.1.68340 WP_003901220.1.68388 WP_003901220.1.68429 WP_003901220.1.68444 WP_003901220.1.68518 WP_003901220.1.68569 WP_003901220.1.68576 WP_003901220.1.68586 WP_003901220.1.68623 WP_003901220.1.68637 WP_003901220.1.68646 WP_003901220.1.68667 WP_003901220.1.68669 WP_003901220.1.68684 WP_003901220.1.68704 WP_003901220.1.68734 WP_003901220.1.68748 WP_003901220.1.68754 WP_003901220.1.6876 WP_003901220.1.68761 WP_003901220.1.68763 WP_003901220.1.68774 WP_003901220.1.68796 WP_003901220.1.68859 WP_003901220.1.68876 WP_003901220.1.68906 WP_003901220.1.68916 WP_003901220.1.68923 WP_003901220.1.6896 WP_003901220.1.68984 WP_003901220.1.68997 WP_003901220.1.69076 WP_003901220.1.6908 WP_003901220.1.69178 WP_003901220.1.69208 WP_003901220.1.69231 WP_003901220.1.69256 WP_003901220.1.69342 WP_003901220.1.69374 WP_003901220.1.69398 WP_003901220.1.69401 WP_003901220.1.69426 WP_003901220.1.69427 WP_003901220.1.69429 WP_003901220.1.6949 WP_003901220.1.69511 WP_003901220.1.69528 WP_003901220.1.69581 WP_003901220.1.6960 WP_003901220.1.69617 WP_003901220.1.69634 WP_003901220.1.69659 WP_003901220.1.69682 WP_003901220.1.69686 WP_003901220.1.69707 WP_003901220.1.69723 WP_003901220.1.69778 WP_003901220.1.69873 WP_003901220.1.69898 WP_003901220.1.69913 WP_003901220.1.69931 WP_003901220.1.69938 WP_003901220.1.69955 WP_003901220.1.69990 WP_003901220.1.70 WP_003901220.1.70000 WP_003901220.1.70017 WP_003901220.1.70032 WP_003901220.1.70055 WP_003901220.1.70062 WP_003901220.1.70072 WP_003901220.1.70132 WP_003901220.1.7022 WP_003901220.1.70227 WP_003901220.1.70255 WP_003901220.1.70271 WP_003901220.1.70274 WP_003901220.1.7029 WP_003901220.1.70325 WP_003901220.1.70328 WP_003901220.1.70356 WP_003901220.1.70364 WP_003901220.1.70368 WP_003901220.1.70418 WP_003901220.1.70422 WP_003901220.1.70435 WP_003901220.1.70471 WP_003901220.1.70494 WP_003901220.1.70573 WP_003901220.1.70577 WP_003901220.1.70610 WP_003901220.1.70615 WP_003901220.1.70618 WP_003901220.1.70626 WP_003901220.1.70668 WP_003901220.1.70699 WP_003901220.1.70704 WP_003901220.1.70729 WP_003901220.1.70757 WP_003901220.1.70782 WP_003901220.1.70796 WP_003901220.1.70834 WP_003901220.1.7084 WP_003901220.1.70840 WP_003901220.1.70864 WP_003901220.1.70871 WP_003901220.1.70915 WP_003901220.1.70958 WP_003901220.1.71015 WP_003901220.1.71063 WP_003901220.1.71076 WP_003901220.1.71083 WP_003901220.1.7111 WP_003901220.1.71118 WP_003901220.1.7113 WP_003901220.1.71187 WP_003901220.1.71191 WP_003901220.1.71255 WP_003901220.1.71258 WP_003901220.1.71329 WP_003901220.1.71331 WP_003901220.1.71344 WP_003901220.1.71390 WP_003901220.1.71440 WP_003901220.1.71457 WP_003901220.1.71464 WP_003901220.1.71490 WP_003901220.1.71492 WP_003901220.1.71516 WP_003901220.1.71517 WP_003901220.1.71527 WP_003901220.1.71532 WP_003901220.1.71545 WP_003901220.1.71546 WP_003901220.1.71569 WP_003901220.1.71604 WP_003901220.1.71630 WP_003901220.1.71654 WP_003901220.1.71665 WP_003901220.1.71731 WP_003901220.1.71778 WP_003901220.1.71803 WP_003901220.1.7185 WP_003901220.1.71851 WP_003901220.1.71871 WP_003901220.1.71957 WP_003901220.1.71970 WP_003901220.1.72072 WP_003901220.1.72122 WP_003901220.1.72168 WP_003901220.1.72179 WP_003901220.1.72209 WP_003901220.1.72227 WP_003901220.1.7224 WP_003901220.1.72268 WP_003901220.1.72332 WP_003901220.1.72380 WP_003901220.1.72401 WP_003901220.1.72441 WP_003901220.1.72452 WP_003901220.1.72457 WP_003901220.1.72460 WP_003901220.1.72466 WP_003901220.1.72487 WP_003901220.1.72488 WP_003901220.1.72492 WP_003901220.1.7256 WP_003901220.1.72576 WP_003901220.1.72578 WP_003901220.1.72585 WP_003901220.1.72591 WP_003901220.1.72592 WP_003901220.1.72640 WP_003901220.1.72739 WP_003901220.1.72755 WP_003901220.1.72759 WP_003901220.1.72784 WP_003901220.1.72792 WP_003901220.1.72853 WP_003901220.1.72879 WP_003901220.1.72938 WP_003901220.1.72954 WP_003901220.1.72959 WP_003901220.1.73006 WP_003901220.1.73013 WP_003901220.1.73025 WP_003901220.1.73028 WP_003901220.1.73042 WP_003901220.1.73045 WP_003901220.1.73092 WP_003901220.1.7312 WP_003901220.1.73127 WP_003901220.1.73134 WP_003901220.1.73154 WP_003901220.1.73182 WP_003901220.1.7321 WP_003901220.1.73310 WP_003901220.1.73365 WP_003901220.1.73391 WP_003901220.1.73404 WP_003901220.1.73436 WP_003901220.1.73453 WP_003901220.1.73465 WP_003901220.1.73466 WP_003901220.1.73470 WP_003901220.1.73471 WP_003901220.1.73478 WP_003901220.1.73482 WP_003901220.1.73532 WP_003901220.1.73550 WP_003901220.1.73623 WP_003901220.1.73629 WP_003901220.1.73644 WP_003901220.1.7366 WP_003901220.1.73661 WP_003901220.1.7368 WP_003901220.1.73688 WP_003901220.1.73723 WP_003901220.1.73750 WP_003901220.1.73774 WP_003901220.1.73840 WP_003901220.1.73876 WP_003901220.1.74016 WP_003901220.1.74039 WP_003901220.1.74101 WP_003901220.1.74107 WP_003901220.1.74129 WP_003901220.1.74144 WP_003901220.1.74190 WP_003901220.1.74210 WP_003901220.1.7423 WP_003901220.1.74269 WP_003901220.1.74282 WP_003901220.1.74291 WP_003901220.1.74296 WP_003901220.1.74304 WP_003901220.1.7432 WP_003901220.1.74347 WP_003901220.1.74378 WP_003901220.1.74382 WP_003901220.1.74395 WP_003901220.1.74400 WP_003901220.1.74432 WP_003901220.1.74442 WP_003901220.1.74487 WP_003901220.1.74499 WP_003901220.1.74504 WP_003901220.1.74511 WP_003901220.1.74523 WP_003901220.1.74525 WP_003901220.1.74551 WP_003901220.1.74641 WP_003901220.1.74653 WP_003901220.1.74683 WP_003901220.1.7469 WP_003901220.1.74725 WP_003901220.1.74760 WP_003901220.1.74820 WP_003901220.1.74870 WP_003901220.1.74881 WP_003901220.1.74888 WP_003901220.1.74952 WP_003901220.1.7496 WP_003901220.1.74988 WP_003901220.1.75043 WP_003901220.1.75055 WP_003901220.1.75081 WP_003901220.1.75120 WP_003901220.1.75163 WP_003901220.1.75188 WP_003901220.1.75202 WP_003901220.1.75234 WP_003901220.1.75239 WP_003901220.1.75263 WP_003901220.1.75342 WP_003901220.1.7535 WP_003901220.1.75391 WP_003901220.1.75395 WP_003901220.1.75510 WP_003901220.1.75581 WP_003901220.1.75598 WP_003901220.1.75635 WP_003901220.1.75665 WP_003901220.1.75671 WP_003901220.1.75741 WP_003901220.1.75749 WP_003901220.1.75772 WP_003901220.1.75774 WP_003901220.1.75864 WP_003901220.1.75868 WP_003901220.1.75878 WP_003901220.1.75927 WP_003901220.1.75946 WP_003901220.1.75968 WP_003901220.1.76045 WP_003901220.1.76052 WP_003901220.1.76058 WP_003901220.1.76064 WP_003901220.1.76110 WP_003901220.1.76138 WP_003901220.1.76157 WP_003901220.1.76177 WP_003901220.1.76183 WP_003901220.1.76209 WP_003901220.1.76272 WP_003901220.1.76277 WP_003901220.1.76281 WP_003901220.1.76297 WP_003901220.1.76379 WP_003901220.1.76413 WP_003901220.1.76436 WP_003901220.1.76533 WP_003901220.1.76616 WP_003901220.1.76638 WP_003901220.1.76640 WP_003901220.1.76644 WP_003901220.1.76677 WP_003901220.1.76678 WP_003901220.1.76734 WP_003901220.1.76744 WP_003901220.1.76750 WP_003901220.1.76754 WP_003901220.1.76757 WP_003901220.1.76781 WP_003901220.1.76824 WP_003901220.1.76835 WP_003901220.1.76888 WP_003901220.1.7691 WP_003901220.1.76947 WP_003901220.1.76954 WP_003901220.1.76963 WP_003901220.1.770 WP_003901220.1.77008 WP_003901220.1.77056 WP_003901220.1.77107 WP_003901220.1.77115 WP_003901220.1.77118 WP_003901220.1.77125 WP_003901220.1.77141 WP_003901220.1.77142 WP_003901220.1.77250 WP_003901220.1.77266 WP_003901220.1.77285 WP_003901220.1.77348 WP_003901220.1.77351 WP_003901220.1.77361 WP_003901220.1.774 WP_003901220.1.77404 WP_003901220.1.77425 WP_003901220.1.77463 WP_003901220.1.77474 WP_003901220.1.77491 WP_003901220.1.77499 WP_003901220.1.77510 WP_003901220.1.77530 WP_003901220.1.77554 WP_003901220.1.77559 WP_003901220.1.7762 WP_003901220.1.77627 WP_003901220.1.77649 WP_003901220.1.7766 WP_003901220.1.77667 WP_003901220.1.77704 WP_003901220.1.77706 WP_003901220.1.77774 WP_003901220.1.7778 WP_003901220.1.77790 WP_003901220.1.77820 WP_003901220.1.77843 WP_003901220.1.77855 WP_003901220.1.77868 WP_003901220.1.77890 WP_003901220.1.77911 WP_003901220.1.77984 WP_003901220.1.78020 WP_003901220.1.78075 WP_003901220.1.7809 WP_003901220.1.78098 WP_003901220.1.78105 WP_003901220.1.78113 WP_003901220.1.78136 WP_003901220.1.7817 WP_003901220.1.78200 WP_003901220.1.78216 WP_003901220.1.78236 WP_003901220.1.78238 WP_003901220.1.78322 WP_003901220.1.78338 WP_003901220.1.7836 WP_003901220.1.78360 WP_003901220.1.78386 WP_003901220.1.78435 WP_003901220.1.7844 WP_003901220.1.78459 WP_003901220.1.78488 WP_003901220.1.7849 WP_003901220.1.78499 WP_003901220.1.785 WP_003901220.1.78516 WP_003901220.1.78526 WP_003901220.1.78538 WP_003901220.1.78547 WP_003901220.1.78574 WP_003901220.1.78580 WP_003901220.1.7860 WP_003901220.1.78646 WP_003901220.1.78648 WP_003901220.1.78649 WP_003901220.1.78657 WP_003901220.1.78659 WP_003901220.1.7869 WP_003901220.1.78692 WP_003901220.1.78766 WP_003901220.1.78788 WP_003901220.1.78790 WP_003901220.1.78860 WP_003901220.1.7887 WP_003901220.1.78884 WP_003901220.1.78932 WP_003901220.1.78969 WP_003901220.1.78977 WP_003901220.1.79005 WP_003901220.1.79016 WP_003901220.1.79064 WP_003901220.1.79066 WP_003901220.1.79068 WP_003901220.1.79095 WP_003901220.1.79122 WP_003901220.1.79152 WP_003901220.1.79163 WP_003901220.1.79213 WP_003901220.1.79218 WP_003901220.1.79268 WP_003901220.1.79278 WP_003901220.1.79319 WP_003901220.1.79326 WP_003901220.1.7933 WP_003901220.1.79330 WP_003901220.1.79339 WP_003901220.1.79394 WP_003901220.1.79399 WP_003901220.1.79413 WP_003901220.1.79422 WP_003901220.1.79445 WP_003901220.1.79447 WP_003901220.1.79455 WP_003901220.1.79471 WP_003901220.1.79480 WP_003901220.1.79482 WP_003901220.1.79488 WP_003901220.1.79500 WP_003901220.1.79502 WP_003901220.1.79508 WP_003901220.1.79514 WP_003901220.1.79561 WP_003901220.1.79565 WP_003901220.1.79578 WP_003901220.1.79588 WP_003901220.1.79598 WP_003901220.1.79615 WP_003901220.1.79744 WP_003901220.1.79784 WP_003901220.1.79806 WP_003901220.1.79826 WP_003901220.1.79828 WP_003901220.1.79863 WP_003901220.1.79881 WP_003901220.1.79885 WP_003901220.1.79898 WP_003901220.1.7990 WP_003901220.1.79900 WP_003901220.1.79918 WP_003901220.1.79947 WP_003901220.1.79948 WP_003901220.1.7995 WP_003901220.1.7997 WP_003901220.1.80004 WP_003901220.1.80022 WP_003901220.1.80030 WP_003901220.1.80054 WP_003901220.1.80084 WP_003901220.1.80099 WP_003901220.1.80129 WP_003901220.1.80177 WP_003901220.1.80234 WP_003901220.1.8026 WP_003901220.1.80275 WP_003901220.1.8029 WP_003901220.1.80299 WP_003901220.1.80304 WP_003901220.1.80326 WP_003901220.1.8037 WP_003901220.1.80370 WP_003901220.1.8044 WP_003901220.1.80458 WP_003901220.1.80461 WP_003901220.1.80490 WP_003901220.1.80507 WP_003901220.1.80552 WP_003901220.1.80576 WP_003901220.1.80588 WP_003901220.1.80599 WP_003901220.1.8060 WP_003901220.1.80636 WP_003901220.1.80743 WP_003901220.1.80784 WP_003901220.1.80853 WP_003901220.1.80918 WP_003901220.1.8093 WP_003901220.1.80967 WP_003901220.1.81007 WP_003901220.1.8105 WP_003901220.1.81059 WP_003901220.1.81063 WP_003901220.1.81066 WP_003901220.1.81091 WP_003901220.1.81119 WP_003901220.1.81125 WP_003901220.1.81136 WP_003901220.1.81189 WP_003901220.1.81192 WP_003901220.1.812 WP_003901220.1.81249 WP_003901220.1.81250 WP_003901220.1.81264 WP_003901220.1.81287 WP_003901220.1.81297 WP_003901220.1.8138 WP_003901220.1.81407 WP_003901220.1.8143 WP_003901220.1.81529 WP_003901220.1.81538 WP_003901220.1.81560 WP_003901220.1.81561 WP_003901220.1.81567 WP_003901220.1.81583 WP_003901220.1.81686 WP_003901220.1.81712 WP_003901220.1.81720 WP_003901220.1.81774 WP_003901220.1.81788 WP_003901220.1.81850 WP_003901220.1.81883 WP_003901220.1.81891 WP_003901220.1.81918 WP_003901220.1.82011 WP_003901220.1.82069 WP_003901220.1.82071 WP_003901220.1.82108 WP_003901220.1.82136 WP_003901220.1.82142 WP_003901220.1.8215 WP_003901220.1.82158 WP_003901220.1.82210 WP_003901220.1.82228 WP_003901220.1.82236 WP_003901220.1.82251 WP_003901220.1.82271 WP_003901220.1.82305 WP_003901220.1.82307 WP_003901220.1.82317 WP_003901220.1.8232 WP_003901220.1.82346 WP_003901220.1.82374 WP_003901220.1.82385 WP_003901220.1.82429 WP_003901220.1.82460 WP_003901220.1.82494 WP_003901220.1.82531 WP_003901220.1.82546 WP_003901220.1.82549 WP_003901220.1.82592 WP_003901220.1.82597 WP_003901220.1.82598 WP_003901220.1.82625 WP_003901220.1.82642 WP_003901220.1.82651 WP_003901220.1.82653 WP_003901220.1.82681 WP_003901220.1.82685 WP_003901220.1.82712 WP_003901220.1.8273 WP_003901220.1.82743 WP_003901220.1.82757 WP_003901220.1.82803 WP_003901220.1.82871 WP_003901220.1.82892 WP_003901220.1.82957 WP_003901220.1.82981 WP_003901220.1.82983 WP_003901220.1.83004 WP_003901220.1.83009 WP_003901220.1.83044 WP_003901220.1.83065 WP_003901220.1.83074 WP_003901220.1.83159 WP_003901220.1.8317 WP_003901220.1.83173 WP_003901220.1.83182 WP_003901220.1.83191 WP_003901220.1.83197 WP_003901220.1.83212 WP_003901220.1.8326 WP_003901220.1.83262 WP_003901220.1.83273 WP_003901220.1.83309 WP_003901220.1.83332 WP_003901220.1.83341 WP_003901220.1.83349 WP_003901220.1.8335 WP_003901220.1.83353 WP_003901220.1.83367 WP_003901220.1.83381 WP_003901220.1.83389 WP_003901220.1.83408 WP_003901220.1.83409 WP_003901220.1.83470 WP_003901220.1.83524 WP_003901220.1.83526 WP_003901220.1.83611 WP_003901220.1.83638 WP_003901220.1.83667 WP_003901220.1.83689 WP_003901220.1.83705 WP_003901220.1.83805 WP_003901220.1.83839 WP_003901220.1.83850 WP_003901220.1.83920 WP_003901220.1.83929 WP_003901220.1.83975 WP_003901220.1.8400 WP_003901220.1.84027 WP_003901220.1.8404 WP_003901220.1.84057 WP_003901220.1.84070 WP_003901220.1.8409 WP_003901220.1.84112 WP_003901220.1.84146 WP_003901220.1.84176 WP_003901220.1.8424 WP_003901220.1.84244 WP_003901220.1.84259 WP_003901220.1.8426 WP_003901220.1.84287 WP_003901220.1.84388 WP_003901220.1.84409 WP_003901220.1.84438 WP_003901220.1.84460 WP_003901220.1.84488 WP_003901220.1.84504 WP_003901220.1.84525 WP_003901220.1.84641 WP_003901220.1.84655 WP_003901220.1.84666 WP_003901220.1.84739 WP_003901220.1.84748 WP_003901220.1.84766 WP_003901220.1.84772 WP_003901220.1.84774 WP_003901220.1.848 WP_003901220.1.84812 WP_003901220.1.84836 WP_003901220.1.84846 WP_003901220.1.84873 WP_003901220.1.84938 WP_003901220.1.84973 WP_003901220.1.84981 WP_003901220.1.84985 WP_003901220.1.8503 WP_003901220.1.85038 WP_003901220.1.85043 WP_003901220.1.8505 WP_003901220.1.8509 WP_003901220.1.8512 WP_003901220.1.8518 WP_003901220.1.8522 WP_003901220.1.85242 WP_003901220.1.85276 WP_003901220.1.85284 WP_003901220.1.85314 WP_003901220.1.85319 WP_003901220.1.85330 WP_003901220.1.85341 WP_003901220.1.8535 WP_003901220.1.85363 WP_003901220.1.85377 WP_003901220.1.85387 WP_003901220.1.85399 WP_003901220.1.85458 WP_003901220.1.8546 WP_003901220.1.85478 WP_003901220.1.85480 WP_003901220.1.85488 WP_003901220.1.85495 WP_003901220.1.85551 WP_003901220.1.85577 WP_003901220.1.85599 WP_003901220.1.85610 WP_003901220.1.85648 WP_003901220.1.85679 WP_003901220.1.85704 WP_003901220.1.85717 WP_003901220.1.85737 WP_003901220.1.85763 WP_003901220.1.85808 WP_003901220.1.85819 WP_003901220.1.85820 WP_003901220.1.85823 WP_003901220.1.85832 WP_003901220.1.8586 WP_003901220.1.85872 WP_003901220.1.85894 WP_003901220.1.85913 WP_003901220.1.85953 WP_003901220.1.85986 WP_003901220.1.86000 WP_003901220.1.86025 WP_003901220.1.86032 WP_003901220.1.86048 WP_003901220.1.86052 WP_003901220.1.86103 WP_003901220.1.86122 WP_003901220.1.86124 WP_003901220.1.86164 WP_003901220.1.86204 WP_003901220.1.86208 WP_003901220.1.86235 WP_003901220.1.86249 WP_003901220.1.86260 WP_003901220.1.86290 WP_003901220.1.863 WP_003901220.1.86327 WP_003901220.1.86334 WP_003901220.1.86368 WP_003901220.1.86377 WP_003901220.1.86425 WP_003901220.1.86459 WP_003901220.1.8649 WP_003901220.1.86499 WP_003901220.1.86561 WP_003901220.1.86568 WP_003901220.1.86575 WP_003901220.1.86584 WP_003901220.1.86605 WP_003901220.1.86648 WP_003901220.1.86684 WP_003901220.1.86696 WP_003901220.1.86718 WP_003901220.1.86725 WP_003901220.1.86766 WP_003901220.1.86801 WP_003901220.1.86814 WP_003901220.1.86820 WP_003901220.1.86825 WP_003901220.1.8685 WP_003901220.1.86851 WP_003901220.1.86855 WP_003901220.1.86867 WP_003901220.1.86892 WP_003901220.1.86941 WP_003901220.1.86950 WP_003901220.1.86963 WP_003901220.1.86979 WP_003901220.1.8700 WP_003901220.1.87002 WP_003901220.1.87031 WP_003901220.1.87116 WP_003901220.1.87117 WP_003901220.1.8714 WP_003901220.1.87209 WP_003901220.1.87240 WP_003901220.1.87266 WP_003901220.1.87275 WP_003901220.1.8733 WP_003901220.1.87345 WP_003901220.1.87401 WP_003901220.1.87446 WP_003901220.1.87459 WP_003901220.1.87489 WP_003901220.1.87494 WP_003901220.1.87588 WP_003901220.1.87617 WP_003901220.1.87619 WP_003901220.1.87634 WP_003901220.1.87643 WP_003901220.1.8765 WP_003901220.1.87650 WP_003901220.1.87654 WP_003901220.1.87658 WP_003901220.1.87665 WP_003901220.1.87676 WP_003901220.1.87684 WP_003901220.1.87692 WP_003901220.1.87707 WP_003901220.1.87732 WP_003901220.1.87784 WP_003901220.1.87796 WP_003901220.1.87809 WP_003901220.1.87827 WP_003901220.1.87831 WP_003901220.1.87835 WP_003901220.1.87866 WP_003901220.1.8789 WP_003901220.1.87911 WP_003901220.1.87991 WP_003901220.1.88 WP_003901220.1.88039 WP_003901220.1.88191 WP_003901220.1.88205 WP_003901220.1.88217 WP_003901220.1.88245 WP_003901220.1.88253 WP_003901220.1.88294 WP_003901220.1.88315 WP_003901220.1.88320 WP_003901220.1.88338 WP_003901220.1.8840 WP_003901220.1.88437 WP_003901220.1.88453 WP_003901220.1.88489 WP_003901220.1.88530 WP_003901220.1.88537 WP_003901220.1.88592 WP_003901220.1.88616 WP_003901220.1.88618 WP_003901220.1.8862 WP_003901220.1.88625 WP_003901220.1.88632 WP_003901220.1.88634 WP_003901220.1.88649 WP_003901220.1.8870 WP_003901220.1.88737 WP_003901220.1.888 WP_003901220.1.88824 WP_003901220.1.88886 WP_003901220.1.88965 WP_003901220.1.88985 WP_003901220.1.8902 WP_003901220.1.89025 WP_003901220.1.89041 WP_003901220.1.89046 WP_003901220.1.89162 WP_003901220.1.89168 WP_003901220.1.8917 WP_003901220.1.89205 WP_003901220.1.89225 WP_003901220.1.8925 WP_003901220.1.89277 WP_003901220.1.89286 WP_003901220.1.89293 WP_003901220.1.89320 WP_003901220.1.8935 WP_003901220.1.89371 WP_003901220.1.89378 WP_003901220.1.89392 WP_003901220.1.89451 WP_003901220.1.89453 WP_003901220.1.89473 WP_003901220.1.895 WP_003901220.1.89513 WP_003901220.1.89517 WP_003901220.1.8954 WP_003901220.1.8957 WP_003901220.1.89589 WP_003901220.1.89607 WP_003901220.1.89613 WP_003901220.1.89625 WP_003901220.1.89648 WP_003901220.1.89670 WP_003901220.1.89676 WP_003901220.1.89762 WP_003901220.1.89808 WP_003901220.1.8982 WP_003901220.1.89829 WP_003901220.1.89831 WP_003901220.1.89844 WP_003901220.1.89849 WP_003901220.1.8989 WP_003901220.1.89903 WP_003901220.1.89909 WP_003901220.1.89922 WP_003901220.1.89926 WP_003901220.1.89963 WP_003901220.1.8998 WP_003901220.1.900 WP_003901220.1.90048 WP_003901220.1.9007 WP_003901220.1.90080 WP_003901220.1.90130 WP_003901220.1.90134 WP_003901220.1.90137 WP_003901220.1.90157 WP_003901220.1.90184 WP_003901220.1.90199 WP_003901220.1.90231 WP_003901220.1.90308 WP_003901220.1.90322 WP_003901220.1.90328 WP_003901220.1.90372 WP_003901220.1.90481 WP_003901220.1.90499 WP_003901220.1.9050 WP_003901220.1.90527 WP_003901220.1.90560 WP_003901220.1.90612 WP_003901220.1.90691 WP_003901220.1.90711 WP_003901220.1.90722 WP_003901220.1.90756 WP_003901220.1.90767 WP_003901220.1.90771 WP_003901220.1.90785 WP_003901220.1.90788 WP_003901220.1.90800 WP_003901220.1.90816 WP_003901220.1.90819 WP_003901220.1.9082 WP_003901220.1.90831 WP_003901220.1.90899 WP_003901220.1.90906 WP_003901220.1.90958 WP_003901220.1.90976 WP_003901220.1.90987 WP_003901220.1.9102 WP_003901220.1.91032 WP_003901220.1.91053 WP_003901220.1.91112 WP_003901220.1.91144 WP_003901220.1.91151 WP_003901220.1.91167 WP_003901220.1.91169 WP_003901220.1.91192 WP_003901220.1.91201 WP_003901220.1.91207 WP_003901220.1.91208 WP_003901220.1.91214 WP_003901220.1.91244 WP_003901220.1.91251 WP_003901220.1.91260 WP_003901220.1.91284 WP_003901220.1.91303 WP_003901220.1.91322 WP_003901220.1.91386 WP_003901220.1.9139 WP_003901220.1.91398 WP_003901220.1.91430 WP_003901220.1.91436 WP_003901220.1.91496 WP_003901220.1.91507 WP_003901220.1.91576 WP_003901220.1.91589 WP_003901220.1.91694 WP_003901220.1.91716 WP_003901220.1.91717 WP_003901220.1.91728 WP_003901220.1.91743 WP_003901220.1.91759 WP_003901220.1.91784 WP_003901220.1.91785 WP_003901220.1.91822 WP_003901220.1.9189 WP_003901220.1.91896 WP_003901220.1.91915 WP_003901220.1.91937 WP_003901220.1.91944 WP_003901220.1.91953 WP_003901220.1.91957 WP_003901220.1.91976 WP_003901220.1.92083 WP_003901220.1.92127 WP_003901220.1.92144 WP_003901220.1.92150 WP_003901220.1.92153 WP_003901220.1.92190 WP_003901220.1.92192 WP_003901220.1.92220 WP_003901220.1.92221 WP_003901220.1.92222 WP_003901220.1.9229 WP_003901220.1.92294 WP_003901220.1.92300 WP_003901220.1.92317 WP_003901220.1.92334 WP_003901220.1.92345 WP_003901220.1.92356 WP_003901220.1.92364 WP_003901220.1.92380 WP_003901220.1.92447 WP_003901220.1.92467 WP_003901220.1.92471 WP_003901220.1.92490 WP_003901220.1.92508 WP_003901220.1.9251 WP_003901220.1.92523 WP_003901220.1.92527 WP_003901220.1.92592 WP_003901220.1.92597 WP_003901220.1.92603 WP_003901220.1.92606 WP_003901220.1.92610 WP_003901220.1.92613 WP_003901220.1.9265 WP_003901220.1.92650 WP_003901220.1.92660 WP_003901220.1.92685 WP_003901220.1.92689 WP_003901220.1.92690 WP_003901220.1.9274 WP_003901220.1.92752 WP_003901220.1.92777 WP_003901220.1.92803 WP_003901220.1.92833 WP_003901220.1.92856 WP_003901220.1.92881 WP_003901220.1.92892 WP_003901220.1.92907 WP_003901220.1.92908 WP_003901220.1.92917 WP_003901220.1.92996 WP_003901220.1.93006 WP_003901220.1.93009 WP_003901220.1.93015 WP_003901220.1.93043 WP_003901220.1.93083 WP_003901220.1.93137 WP_003901220.1.93192 WP_003901220.1.93212 WP_003901220.1.93234 WP_003901220.1.93245 WP_003901220.1.93257 WP_003901220.1.93265 WP_003901220.1.93328 WP_003901220.1.93337 WP_003901220.1.93343 WP_003901220.1.93349 WP_003901220.1.93363 WP_003901220.1.93377 WP_003901220.1.9338 WP_003901220.1.93407 WP_003901220.1.93419 WP_003901220.1.93426 WP_003901220.1.9344 WP_003901220.1.93443 WP_003901220.1.93495 WP_003901220.1.93499 WP_003901220.1.93516 WP_003901220.1.93544 WP_003901220.1.93560 WP_003901220.1.93564 WP_003901220.1.93588 WP_003901220.1.9363 WP_003901220.1.93645 WP_003901220.1.93649 WP_003901220.1.93659 WP_003901220.1.93677 WP_003901220.1.9368 WP_003901220.1.93689 WP_003901220.1.93693 WP_003901220.1.93706 WP_003901220.1.9371 WP_003901220.1.93823 WP_003901220.1.9388 WP_003901220.1.93894 WP_003901220.1.93903 WP_003901220.1.93907 WP_003901220.1.93913 WP_003901220.1.93950 WP_003901220.1.93954 WP_003901220.1.93988 WP_003901220.1.9407 WP_003901220.1.94154 WP_003901220.1.94204 WP_003901220.1.94205 WP_003901220.1.94226 WP_003901220.1.94231 WP_003901220.1.94256 WP_003901220.1.94261 WP_003901220.1.94281 WP_003901220.1.94292 WP_003901220.1.94297 WP_003901220.1.94326 WP_003901220.1.94339 WP_003901220.1.94392 WP_003901220.1.94421 WP_003901220.1.94456 WP_003901220.1.94480 WP_003901220.1.94495 WP_003901220.1.94511 WP_003901220.1.94528 WP_003901220.1.94564 WP_003901220.1.94629 WP_003901220.1.9465 WP_003901220.1.94673 WP_003901220.1.94714 WP_003901220.1.94730 WP_003901220.1.94736 WP_003901220.1.94776 WP_003901220.1.94852 WP_003901220.1.94872 WP_003901220.1.9488 WP_003901220.1.94902 WP_003901220.1.94979 WP_003901220.1.94994 WP_003901220.1.94996 WP_003901220.1.94998 WP_003901220.1.95007 WP_003901220.1.95015 WP_003901220.1.95034 WP_003901220.1.95068 WP_003901220.1.95081 WP_003901220.1.95082 WP_003901220.1.9509 WP_003901220.1.95096 WP_003901220.1.95112 WP_003901220.1.9514 WP_003901220.1.95179 WP_003901220.1.95188 WP_003901220.1.95190 WP_003901220.1.95241 WP_003901220.1.95279 WP_003901220.1.9531 WP_003901220.1.95344 WP_003901220.1.9535 WP_003901220.1.95370 WP_003901220.1.95392 WP_003901220.1.95416 WP_003901220.1.95417 WP_003901220.1.95454 WP_003901220.1.95455 WP_003901220.1.95491 WP_003901220.1.95497 WP_003901220.1.95508 WP_003901220.1.95556 WP_003901220.1.95557 WP_003901220.1.95565 WP_003901220.1.95580 WP_003901220.1.95585 WP_003901220.1.95643 WP_003901220.1.95685 WP_003901220.1.95727 WP_003901220.1.95730 WP_003901220.1.95797 WP_003901220.1.95839 WP_003901220.1.9585 WP_003901220.1.9590 WP_003901220.1.95902 WP_003901220.1.95926 WP_003901220.1.95953 WP_003901220.1.95964 WP_003901220.1.95973 WP_003901220.1.96006 WP_003901220.1.96062 WP_003901220.1.96065 WP_003901220.1.96098 WP_003901220.1.96171 WP_003901220.1.96182 WP_003901220.1.96242 WP_003901220.1.96254 WP_003901220.1.96259 WP_003901220.1.96286 WP_003901220.1.96318 WP_003901220.1.96345 WP_003901220.1.96373 WP_003901220.1.96456 WP_003901220.1.96486 WP_003901220.1.96569 WP_003901220.1.96573 WP_003901220.1.96576 WP_003901220.1.96611 WP_003901220.1.96621 WP_003901220.1.96681 WP_003901220.1.96726 WP_003901220.1.96733 WP_003901220.1.96742 WP_003901220.1.96754 WP_003901220.1.9678 WP_003901220.1.9685 WP_003901220.1.97008 WP_003901220.1.97056 WP_003901220.1.97096 WP_003901220.1.97099 WP_003901220.1.97108 WP_003901220.1.97129 WP_003901220.1.97136 WP_003901220.1.9716 WP_003901220.1.97176 WP_003901220.1.97222 WP_003901220.1.97237 WP_003901220.1.97242 WP_003901220.1.97270 WP_003901220.1.97283 WP_003901220.1.97296 WP_003901220.1.97366 WP_003901220.1.97376 WP_003901220.1.97462 WP_003901220.1.97517 WP_003901220.1.97519 WP_003901220.1.97535 WP_003901220.1.97540 WP_003901220.1.97545 WP_003901220.1.97546 WP_003901220.1.97550 WP_003901220.1.97577 WP_003901220.1.97584 WP_003901220.1.9759 WP_003901220.1.97609 WP_003901220.1.97618 WP_003901220.1.9763 WP_003901220.1.97669 WP_003901220.1.97673 WP_003901220.1.9773 WP_003901220.1.97730 WP_003901220.1.97754 WP_003901220.1.97797 WP_003901220.1.9782 WP_003901220.1.97888 WP_003901220.1.9790 WP_003901220.1.97951 WP_003901220.1.97958 WP_003901220.1.97966 WP_003901220.1.97977 WP_003901220.1.97979 WP_003901220.1.97995 WP_003901220.1.98034 WP_003901220.1.98052 WP_003901220.1.98071 WP_003901220.1.98072 WP_003901220.1.98113 WP_003901220.1.98128 WP_003901220.1.98188 WP_003901220.1.98213 WP_003901220.1.98225 WP_003901220.1.98291 WP_003901220.1.98350 WP_003901220.1.98395 WP_003901220.1.98441 WP_003901220.1.98443 WP_003901220.1.98462 WP_003901220.1.9848 WP_003901220.1.98482 WP_003901220.1.98486 WP_003901220.1.98488 WP_003901220.1.98503 WP_003901220.1.98536 WP_003901220.1.98566 WP_003901220.1.98576 WP_003901220.1.98590 WP_003901220.1.98599 WP_003901220.1.98629 WP_003901220.1.98645 WP_003901220.1.98646 WP_003901220.1.98649 WP_003901220.1.98656 WP_003901220.1.9867 WP_003901220.1.98674 WP_003901220.1.98739 WP_003901220.1.98749 WP_003901220.1.98770 WP_003901220.1.98777 WP_003901220.1.98778 WP_003901220.1.98802 WP_003901220.1.98906 WP_003901220.1.98935 WP_003901220.1.98948 WP_003901220.1.98953 WP_003901220.1.99000 WP_003901220.1.99023 WP_003901220.1.99030 WP_003901220.1.99062 WP_003901220.1.99086 WP_003901220.1.99115 WP_003901220.1.99161 WP_003901220.1.99176 WP_003901220.1.99211 WP_003901220.1.99216 WP_003901220.1.99222 WP_003901220.1.99251 WP_003901220.1.99312 WP_003901220.1.99315 WP_003901220.1.99316 WP_003901220.1.99322 WP_003901220.1.99368 WP_003901220.1.99419 WP_003901220.1.99438 WP_003901220.1.99460 WP_003901220.1.99468 WP_003901220.1.99473 WP_003901220.1.99513 WP_003901220.1.99529 WP_003901220.1.99548 WP_003901220.1.99572 WP_003901220.1.99575 WP_003901220.1.99578 WP_003901220.1.99605 WP_003901220.1.99609 WP_003901220.1.99617 WP_003901220.1.99635 WP_003901220.1.99650 WP_003901220.1.99672 WP_003901220.1.99701 WP_003901220.1.99716 WP_003901220.1.99745 WP_003901220.1.99749 WP_003901220.1.9976 WP_003901220.1.99798 WP_003901220.1.99817 WP_003901220.1.99886 WP_003901220.1.99897 WP_003901220.1.99899 WP_003901220.1.99915 gi|253799310|ref|YP_003032311.1| gi|375296556|ref|YP_005100823.1| gi|385998425|ref|YP_005916723.1| gi|15608788|ref|NP_216166.1| gi|15608788|ref|NP_216166.1| 419947.MRA_1661 478434.TBMG_02343 83331.MT1688 83332.Rv1650 gi|392432767|ref|YP_006473811.1| gi|385991048|ref|YP_005909346.1| gi|15841106|ref|NP_336143.1| gi|148661446|ref|YP_001282969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]