SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15608797|ref|NP_216175.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15608797|ref|NP_216175.1|
Domain Number 1 Region: 11-457
Classification Level Classification E-value
Superfamily L-aspartase-like 8.48e-129
Family L-aspartase/fumarase 0.000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15608797|ref|NP_216175.1|
Sequence length 470
Comment Probable argininosuccinate lyase ArgH [Mycobacterium tuberculosis H37Rv]
Sequence
MSTNEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQR
DGLLAGLDSLAQDVADGSFGPLVTDEDVHAALERGLIDRVGPDLGGRLRAGRSRNDQVAA
LFRMWLRDAVRRVATGVLDVVGALAEQAAAHPSAIMPGKTHLQSAQPILLAHHLLAHAHP
LLRDLDRIVDFDKRAAVSPYGSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFA
AEAAFVFAMIAVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGLVASLTFNVQR
MAELAPAGYTLATDLAEWLVRQGVPFRSAHEAAGAAVRAAEQRGVGLQELTDDELAAISP
ELTPQVREVLTIEGSVSARDCRGGTAPGRVAEQLNAIGEAAERLRRQLVR
Download sequence
Identical sequences A0A045ITB4 A0A083W7R7 A0A0H3L9J4 A0A0K2HVX9 A0A109SN37 A0A109SWR1 A0A197IZ93 A0A1S1B7F2 A1KJ76 A5U316 C1ANT2 F8M8P6 I6XC24 M8CN44 P0A4Z1 P9WPY7 R4M717
gi|494700067|ref|YP_007965549.1| gi|506926136|ref|YP_008006586.1| Rv1659 gi|378771401|ref|YP_005171134.1| gi|383307494|ref|YP_005360305.1| gi|339631715|ref|YP_004723357.1| gi|148822868|ref|YP_001287622.1| gi|479314570|ref|YP_007854622.1| 233413.Mb1687 336982.TBFG_11677 410289.BCG_1698 419947.MRA_1670 478434.TBMG_02334 561275.JTY_1673 83332.Rv1659 gi|494692198|ref|YP_007957741.1| gi|506926136|ref|YP_008006586.1| gi|31792846|ref|NP_855339.1| gi|392386331|ref|YP_005307960.1| gi|471337584|ref|YP_007610297.1| gi|525676497|ref|YP_008225766.1| gi|385998434|ref|YP_005916732.1| gi|375296547|ref|YP_005100814.1| gi|253799301|ref|YP_003032302.1| gi|385991057|ref|YP_005909355.1| gi|479055612|ref|YP_007351418.1| gi|197740320|ref|YP_002161634.1| gi|121637567|ref|YP_977790.1| NP_216175.1.84033 WP_003408180.1.100021 WP_003408180.1.100069 WP_003408180.1.100087 WP_003408180.1.10015 WP_003408180.1.100208 WP_003408180.1.100216 WP_003408180.1.10022 WP_003408180.1.100255 WP_003408180.1.100260 WP_003408180.1.100270 WP_003408180.1.100279 WP_003408180.1.100286 WP_003408180.1.100308 WP_003408180.1.100309 WP_003408180.1.100318 WP_003408180.1.100338 WP_003408180.1.10037 WP_003408180.1.100383 WP_003408180.1.100395 WP_003408180.1.100396 WP_003408180.1.1004 WP_003408180.1.100460 WP_003408180.1.100552 WP_003408180.1.100581 WP_003408180.1.100600 WP_003408180.1.100625 WP_003408180.1.10064 WP_003408180.1.100666 WP_003408180.1.100671 WP_003408180.1.100697 WP_003408180.1.100703 WP_003408180.1.100716 WP_003408180.1.100722 WP_003408180.1.100754 WP_003408180.1.100757 WP_003408180.1.100772 WP_003408180.1.1008 WP_003408180.1.100812 WP_003408180.1.100866 WP_003408180.1.10088 WP_003408180.1.100889 WP_003408180.1.100910 WP_003408180.1.100915 WP_003408180.1.100918 WP_003408180.1.100935 WP_003408180.1.100984 WP_003408180.1.100992 WP_003408180.1.100998 WP_003408180.1.101 WP_003408180.1.101025 WP_003408180.1.101028 WP_003408180.1.10104 WP_003408180.1.101048 WP_003408180.1.101054 WP_003408180.1.101075 WP_003408180.1.101143 WP_003408180.1.101146 WP_003408180.1.10116 WP_003408180.1.10117 WP_003408180.1.101209 WP_003408180.1.10125 WP_003408180.1.101290 WP_003408180.1.101323 WP_003408180.1.101324 WP_003408180.1.101350 WP_003408180.1.101367 WP_003408180.1.101398 WP_003408180.1.101403 WP_003408180.1.101421 WP_003408180.1.10144 WP_003408180.1.101442 WP_003408180.1.10145 WP_003408180.1.101452 WP_003408180.1.101456 WP_003408180.1.101481 WP_003408180.1.101493 WP_003408180.1.101496 WP_003408180.1.101533 WP_003408180.1.101535 WP_003408180.1.101553 WP_003408180.1.101558 WP_003408180.1.10156 WP_003408180.1.101573 WP_003408180.1.101576 WP_003408180.1.10159 WP_003408180.1.101592 WP_003408180.1.101604 WP_003408180.1.101607 WP_003408180.1.101622 WP_003408180.1.101644 WP_003408180.1.101659 WP_003408180.1.101671 WP_003408180.1.101687 WP_003408180.1.101698 WP_003408180.1.10170 WP_003408180.1.101713 WP_003408180.1.101722 WP_003408180.1.101733 WP_003408180.1.101764 WP_003408180.1.101795 WP_003408180.1.101797 WP_003408180.1.101798 WP_003408180.1.101802 WP_003408180.1.101826 WP_003408180.1.101836 WP_003408180.1.101858 WP_003408180.1.101859 WP_003408180.1.101888 WP_003408180.1.101894 WP_003408180.1.101899 WP_003408180.1.1019 WP_003408180.1.101923 WP_003408180.1.101925 WP_003408180.1.10193 WP_003408180.1.101996 WP_003408180.1.102 WP_003408180.1.102008 WP_003408180.1.102017 WP_003408180.1.102053 WP_003408180.1.102055 WP_003408180.1.102063 WP_003408180.1.102099 WP_003408180.1.1021 WP_003408180.1.10211 WP_003408180.1.102121 WP_003408180.1.10216 WP_003408180.1.10224 WP_003408180.1.10253 WP_003408180.1.10262 WP_003408180.1.10272 WP_003408180.1.10277 WP_003408180.1.1033 WP_003408180.1.10350 WP_003408180.1.10366 WP_003408180.1.10376 WP_003408180.1.10396 WP_003408180.1.10430 WP_003408180.1.1044 WP_003408180.1.10440 WP_003408180.1.10445 WP_003408180.1.10471 WP_003408180.1.10472 WP_003408180.1.10489 WP_003408180.1.105 WP_003408180.1.10523 WP_003408180.1.10545 WP_003408180.1.1057 WP_003408180.1.10594 WP_003408180.1.10606 WP_003408180.1.10615 WP_003408180.1.10623 WP_003408180.1.10635 WP_003408180.1.10643 WP_003408180.1.10648 WP_003408180.1.10735 WP_003408180.1.10740 WP_003408180.1.10756 WP_003408180.1.1078 WP_003408180.1.10791 WP_003408180.1.10799 WP_003408180.1.10825 WP_003408180.1.10848 WP_003408180.1.10863 WP_003408180.1.10879 WP_003408180.1.10912 WP_003408180.1.10923 WP_003408180.1.10927 WP_003408180.1.1095 WP_003408180.1.10956 WP_003408180.1.10958 WP_003408180.1.10962 WP_003408180.1.10980 WP_003408180.1.10981 WP_003408180.1.10993 WP_003408180.1.1100 WP_003408180.1.11040 WP_003408180.1.11061 WP_003408180.1.11070 WP_003408180.1.11171 WP_003408180.1.11175 WP_003408180.1.11176 WP_003408180.1.11222 WP_003408180.1.11236 WP_003408180.1.11329 WP_003408180.1.1133 WP_003408180.1.11342 WP_003408180.1.11373 WP_003408180.1.11376 WP_003408180.1.11390 WP_003408180.1.11402 WP_003408180.1.11481 WP_003408180.1.11487 WP_003408180.1.11489 WP_003408180.1.11587 WP_003408180.1.11589 WP_003408180.1.11596 WP_003408180.1.11610 WP_003408180.1.11697 WP_003408180.1.11707 WP_003408180.1.11752 WP_003408180.1.11758 WP_003408180.1.11761 WP_003408180.1.11775 WP_003408180.1.11822 WP_003408180.1.11826 WP_003408180.1.11856 WP_003408180.1.11898 WP_003408180.1.11906 WP_003408180.1.11939 WP_003408180.1.11960 WP_003408180.1.11961 WP_003408180.1.11972 WP_003408180.1.120 WP_003408180.1.12001 WP_003408180.1.12049 WP_003408180.1.12052 WP_003408180.1.12100 WP_003408180.1.12116 WP_003408180.1.12133 WP_003408180.1.12161 WP_003408180.1.12165 WP_003408180.1.12184 WP_003408180.1.12187 WP_003408180.1.12190 WP_003408180.1.12216 WP_003408180.1.12265 WP_003408180.1.12275 WP_003408180.1.12293 WP_003408180.1.12294 WP_003408180.1.123 WP_003408180.1.1231 WP_003408180.1.12314 WP_003408180.1.12338 WP_003408180.1.1236 WP_003408180.1.12371 WP_003408180.1.12372 WP_003408180.1.12389 WP_003408180.1.12406 WP_003408180.1.12421 WP_003408180.1.12446 WP_003408180.1.12464 WP_003408180.1.12479 WP_003408180.1.12523 WP_003408180.1.12526 WP_003408180.1.1255 WP_003408180.1.12550 WP_003408180.1.12551 WP_003408180.1.12563 WP_003408180.1.12611 WP_003408180.1.12669 WP_003408180.1.12672 WP_003408180.1.12692 WP_003408180.1.1271 WP_003408180.1.12710 WP_003408180.1.12768 WP_003408180.1.1279 WP_003408180.1.12801 WP_003408180.1.12804 WP_003408180.1.12821 WP_003408180.1.12841 WP_003408180.1.12871 WP_003408180.1.12901 WP_003408180.1.12941 WP_003408180.1.12947 WP_003408180.1.12957 WP_003408180.1.12972 WP_003408180.1.13028 WP_003408180.1.13043 WP_003408180.1.13086 WP_003408180.1.13087 WP_003408180.1.13090 WP_003408180.1.13096 WP_003408180.1.13175 WP_003408180.1.13183 WP_003408180.1.132 WP_003408180.1.13249 WP_003408180.1.13282 WP_003408180.1.13284 WP_003408180.1.13296 WP_003408180.1.13306 WP_003408180.1.13312 WP_003408180.1.13313 WP_003408180.1.13321 WP_003408180.1.13345 WP_003408180.1.13358 WP_003408180.1.13370 WP_003408180.1.13375 WP_003408180.1.1338 WP_003408180.1.13420 WP_003408180.1.13433 WP_003408180.1.13435 WP_003408180.1.13438 WP_003408180.1.13461 WP_003408180.1.13466 WP_003408180.1.13489 WP_003408180.1.13551 WP_003408180.1.13561 WP_003408180.1.13579 WP_003408180.1.13647 WP_003408180.1.13687 WP_003408180.1.13697 WP_003408180.1.13719 WP_003408180.1.13763 WP_003408180.1.1377 WP_003408180.1.13774 WP_003408180.1.13786 WP_003408180.1.13793 WP_003408180.1.13794 WP_003408180.1.13817 WP_003408180.1.13834 WP_003408180.1.13866 WP_003408180.1.13909 WP_003408180.1.13910 WP_003408180.1.13919 WP_003408180.1.13920 WP_003408180.1.13953 WP_003408180.1.13962 WP_003408180.1.1398 WP_003408180.1.13988 WP_003408180.1.14027 WP_003408180.1.14046 WP_003408180.1.14115 WP_003408180.1.1415 WP_003408180.1.14152 WP_003408180.1.14158 WP_003408180.1.14175 WP_003408180.1.14178 WP_003408180.1.14195 WP_003408180.1.14208 WP_003408180.1.14238 WP_003408180.1.14266 WP_003408180.1.14273 WP_003408180.1.14303 WP_003408180.1.14306 WP_003408180.1.14307 WP_003408180.1.14310 WP_003408180.1.14416 WP_003408180.1.14428 WP_003408180.1.14441 WP_003408180.1.14469 WP_003408180.1.14477 WP_003408180.1.14504 WP_003408180.1.14514 WP_003408180.1.1452 WP_003408180.1.14527 WP_003408180.1.1454 WP_003408180.1.14548 WP_003408180.1.14551 WP_003408180.1.14561 WP_003408180.1.14573 WP_003408180.1.1462 WP_003408180.1.14658 WP_003408180.1.14667 WP_003408180.1.14668 WP_003408180.1.14675 WP_003408180.1.14694 WP_003408180.1.14695 WP_003408180.1.14709 WP_003408180.1.14766 WP_003408180.1.14783 WP_003408180.1.14865 WP_003408180.1.14872 WP_003408180.1.14905 WP_003408180.1.14926 WP_003408180.1.14951 WP_003408180.1.14955 WP_003408180.1.15003 WP_003408180.1.15009 WP_003408180.1.15028 WP_003408180.1.15040 WP_003408180.1.15052 WP_003408180.1.15065 WP_003408180.1.15072 WP_003408180.1.15089 WP_003408180.1.1509 WP_003408180.1.15126 WP_003408180.1.15131 WP_003408180.1.15168 WP_003408180.1.15172 WP_003408180.1.15174 WP_003408180.1.15187 WP_003408180.1.15196 WP_003408180.1.15210 WP_003408180.1.15216 WP_003408180.1.15217 WP_003408180.1.1523 WP_003408180.1.15232 WP_003408180.1.15238 WP_003408180.1.15240 WP_003408180.1.15253 WP_003408180.1.1527 WP_003408180.1.15292 WP_003408180.1.15299 WP_003408180.1.15302 WP_003408180.1.15322 WP_003408180.1.1534 WP_003408180.1.15365 WP_003408180.1.15386 WP_003408180.1.15387 WP_003408180.1.15447 WP_003408180.1.15449 WP_003408180.1.15477 WP_003408180.1.15481 WP_003408180.1.15492 WP_003408180.1.15511 WP_003408180.1.15512 WP_003408180.1.15558 WP_003408180.1.15559 WP_003408180.1.15566 WP_003408180.1.15599 WP_003408180.1.15611 WP_003408180.1.1563 WP_003408180.1.15633 WP_003408180.1.15643 WP_003408180.1.15688 WP_003408180.1.15755 WP_003408180.1.15763 WP_003408180.1.15774 WP_003408180.1.15780 WP_003408180.1.15827 WP_003408180.1.15834 WP_003408180.1.15842 WP_003408180.1.15853 WP_003408180.1.15870 WP_003408180.1.15877 WP_003408180.1.15893 WP_003408180.1.15896 WP_003408180.1.15926 WP_003408180.1.15933 WP_003408180.1.15946 WP_003408180.1.15958 WP_003408180.1.15973 WP_003408180.1.15987 WP_003408180.1.15993 WP_003408180.1.16009 WP_003408180.1.16025 WP_003408180.1.16043 WP_003408180.1.16066 WP_003408180.1.16069 WP_003408180.1.16077 WP_003408180.1.16106 WP_003408180.1.16108 WP_003408180.1.16130 WP_003408180.1.16136 WP_003408180.1.16139 WP_003408180.1.16141 WP_003408180.1.16143 WP_003408180.1.1630 WP_003408180.1.16318 WP_003408180.1.1632 WP_003408180.1.16327 WP_003408180.1.16334 WP_003408180.1.16341 WP_003408180.1.16345 WP_003408180.1.16374 WP_003408180.1.16384 WP_003408180.1.16386 WP_003408180.1.164 WP_003408180.1.1642 WP_003408180.1.16421 WP_003408180.1.16431 WP_003408180.1.16438 WP_003408180.1.1644 WP_003408180.1.16442 WP_003408180.1.16448 WP_003408180.1.16451 WP_003408180.1.16476 WP_003408180.1.16480 WP_003408180.1.1652 WP_003408180.1.16549 WP_003408180.1.16560 WP_003408180.1.16598 WP_003408180.1.16619 WP_003408180.1.16620 WP_003408180.1.16622 WP_003408180.1.16637 WP_003408180.1.1669 WP_003408180.1.16707 WP_003408180.1.16724 WP_003408180.1.16731 WP_003408180.1.16743 WP_003408180.1.1683 WP_003408180.1.16837 WP_003408180.1.16852 WP_003408180.1.16940 WP_003408180.1.16950 WP_003408180.1.16959 WP_003408180.1.16968 WP_003408180.1.1697 WP_003408180.1.16973 WP_003408180.1.16977 WP_003408180.1.16987 WP_003408180.1.17005 WP_003408180.1.17010 WP_003408180.1.17015 WP_003408180.1.17019 WP_003408180.1.17039 WP_003408180.1.17052 WP_003408180.1.17057 WP_003408180.1.1707 WP_003408180.1.17094 WP_003408180.1.17130 WP_003408180.1.17138 WP_003408180.1.17147 WP_003408180.1.17224 WP_003408180.1.17251 WP_003408180.1.17288 WP_003408180.1.17304 WP_003408180.1.17314 WP_003408180.1.17345 WP_003408180.1.17381 WP_003408180.1.17391 WP_003408180.1.17412 WP_003408180.1.1743 WP_003408180.1.17440 WP_003408180.1.17466 WP_003408180.1.17477 WP_003408180.1.17483 WP_003408180.1.17505 WP_003408180.1.17527 WP_003408180.1.17535 WP_003408180.1.17540 WP_003408180.1.17553 WP_003408180.1.17558 WP_003408180.1.17599 WP_003408180.1.17655 WP_003408180.1.17679 WP_003408180.1.1768 WP_003408180.1.17687 WP_003408180.1.17700 WP_003408180.1.17710 WP_003408180.1.17713 WP_003408180.1.17722 WP_003408180.1.17798 WP_003408180.1.17803 WP_003408180.1.17816 WP_003408180.1.17821 WP_003408180.1.17830 WP_003408180.1.17868 WP_003408180.1.17878 WP_003408180.1.1792 WP_003408180.1.17923 WP_003408180.1.1795 WP_003408180.1.17955 WP_003408180.1.17973 WP_003408180.1.18009 WP_003408180.1.18057 WP_003408180.1.18065 WP_003408180.1.18070 WP_003408180.1.18116 WP_003408180.1.18120 WP_003408180.1.18126 WP_003408180.1.1817 WP_003408180.1.18170 WP_003408180.1.18206 WP_003408180.1.18216 WP_003408180.1.18240 WP_003408180.1.18297 WP_003408180.1.18306 WP_003408180.1.18364 WP_003408180.1.18399 WP_003408180.1.18411 WP_003408180.1.18444 WP_003408180.1.18448 WP_003408180.1.18467 WP_003408180.1.18476 WP_003408180.1.18522 WP_003408180.1.18580 WP_003408180.1.18587 WP_003408180.1.186 WP_003408180.1.18601 WP_003408180.1.18639 WP_003408180.1.18646 WP_003408180.1.18647 WP_003408180.1.18694 WP_003408180.1.18710 WP_003408180.1.18751 WP_003408180.1.18781 WP_003408180.1.18793 WP_003408180.1.18804 WP_003408180.1.18816 WP_003408180.1.18823 WP_003408180.1.18838 WP_003408180.1.18849 WP_003408180.1.18856 WP_003408180.1.18945 WP_003408180.1.1898 WP_003408180.1.19005 WP_003408180.1.19056 WP_003408180.1.19066 WP_003408180.1.19071 WP_003408180.1.19085 WP_003408180.1.19094 WP_003408180.1.19144 WP_003408180.1.19159 WP_003408180.1.19193 WP_003408180.1.19231 WP_003408180.1.19243 WP_003408180.1.19264 WP_003408180.1.19295 WP_003408180.1.19307 WP_003408180.1.19326 WP_003408180.1.19364 WP_003408180.1.19382 WP_003408180.1.19400 WP_003408180.1.19426 WP_003408180.1.19429 WP_003408180.1.19480 WP_003408180.1.19562 WP_003408180.1.19564 WP_003408180.1.19568 WP_003408180.1.19572 WP_003408180.1.19595 WP_003408180.1.19596 WP_003408180.1.19600 WP_003408180.1.19630 WP_003408180.1.1967 WP_003408180.1.19694 WP_003408180.1.1970 WP_003408180.1.19707 WP_003408180.1.19742 WP_003408180.1.19785 WP_003408180.1.19820 WP_003408180.1.19874 WP_003408180.1.19900 WP_003408180.1.19922 WP_003408180.1.19936 WP_003408180.1.19946 WP_003408180.1.19949 WP_003408180.1.19960 WP_003408180.1.19964 WP_003408180.1.20007 WP_003408180.1.20016 WP_003408180.1.2003 WP_003408180.1.20037 WP_003408180.1.20039 WP_003408180.1.20082 WP_003408180.1.20085 WP_003408180.1.20097 WP_003408180.1.20116 WP_003408180.1.20130 WP_003408180.1.20140 WP_003408180.1.20141 WP_003408180.1.20142 WP_003408180.1.20239 WP_003408180.1.20243 WP_003408180.1.20259 WP_003408180.1.20262 WP_003408180.1.20272 WP_003408180.1.20280 WP_003408180.1.20294 WP_003408180.1.20300 WP_003408180.1.20309 WP_003408180.1.2037 WP_003408180.1.20372 WP_003408180.1.20381 WP_003408180.1.20427 WP_003408180.1.20457 WP_003408180.1.20459 WP_003408180.1.20460 WP_003408180.1.20542 WP_003408180.1.20578 WP_003408180.1.20608 WP_003408180.1.20624 WP_003408180.1.20628 WP_003408180.1.2066 WP_003408180.1.20707 WP_003408180.1.20722 WP_003408180.1.20729 WP_003408180.1.20742 WP_003408180.1.20751 WP_003408180.1.20776 WP_003408180.1.20843 WP_003408180.1.20850 WP_003408180.1.2086 WP_003408180.1.20868 WP_003408180.1.20876 WP_003408180.1.20897 WP_003408180.1.20898 WP_003408180.1.2090 WP_003408180.1.20911 WP_003408180.1.20921 WP_003408180.1.20926 WP_003408180.1.20927 WP_003408180.1.20951 WP_003408180.1.20970 WP_003408180.1.2104 WP_003408180.1.21070 WP_003408180.1.21127 WP_003408180.1.21135 WP_003408180.1.21173 WP_003408180.1.212 WP_003408180.1.2120 WP_003408180.1.21218 WP_003408180.1.21219 WP_003408180.1.2123 WP_003408180.1.21231 WP_003408180.1.21234 WP_003408180.1.2126 WP_003408180.1.21292 WP_003408180.1.21307 WP_003408180.1.2131 WP_003408180.1.21311 WP_003408180.1.21321 WP_003408180.1.21365 WP_003408180.1.21392 WP_003408180.1.21397 WP_003408180.1.21403 WP_003408180.1.21415 WP_003408180.1.21418 WP_003408180.1.21430 WP_003408180.1.21434 WP_003408180.1.21468 WP_003408180.1.21498 WP_003408180.1.21509 WP_003408180.1.21513 WP_003408180.1.21560 WP_003408180.1.21565 WP_003408180.1.21586 WP_003408180.1.21591 WP_003408180.1.21594 WP_003408180.1.21602 WP_003408180.1.21615 WP_003408180.1.21638 WP_003408180.1.21639 WP_003408180.1.21655 WP_003408180.1.2168 WP_003408180.1.2174 WP_003408180.1.21741 WP_003408180.1.21742 WP_003408180.1.21777 WP_003408180.1.21786 WP_003408180.1.21795 WP_003408180.1.21826 WP_003408180.1.21829 WP_003408180.1.21840 WP_003408180.1.21843 WP_003408180.1.21872 WP_003408180.1.2188 WP_003408180.1.21882 WP_003408180.1.21906 WP_003408180.1.21912 WP_003408180.1.2194 WP_003408180.1.21941 WP_003408180.1.21956 WP_003408180.1.21958 WP_003408180.1.21960 WP_003408180.1.21971 WP_003408180.1.21973 WP_003408180.1.21983 WP_003408180.1.22003 WP_003408180.1.22013 WP_003408180.1.22025 WP_003408180.1.22036 WP_003408180.1.22075 WP_003408180.1.22092 WP_003408180.1.2212 WP_003408180.1.22127 WP_003408180.1.22140 WP_003408180.1.22233 WP_003408180.1.22255 WP_003408180.1.22277 WP_003408180.1.22348 WP_003408180.1.22366 WP_003408180.1.2238 WP_003408180.1.22380 WP_003408180.1.22437 WP_003408180.1.22438 WP_003408180.1.22511 WP_003408180.1.22524 WP_003408180.1.2253 WP_003408180.1.22585 WP_003408180.1.22606 WP_003408180.1.22608 WP_003408180.1.22609 WP_003408180.1.22618 WP_003408180.1.2262 WP_003408180.1.22624 WP_003408180.1.22629 WP_003408180.1.22647 WP_003408180.1.22664 WP_003408180.1.22665 WP_003408180.1.22670 WP_003408180.1.22680 WP_003408180.1.22725 WP_003408180.1.22728 WP_003408180.1.22733 WP_003408180.1.22737 WP_003408180.1.2275 WP_003408180.1.22754 WP_003408180.1.22800 WP_003408180.1.22804 WP_003408180.1.22829 WP_003408180.1.22840 WP_003408180.1.22970 WP_003408180.1.22996 WP_003408180.1.22997 WP_003408180.1.22999 WP_003408180.1.23015 WP_003408180.1.23032 WP_003408180.1.231 WP_003408180.1.23101 WP_003408180.1.2312 WP_003408180.1.23140 WP_003408180.1.23153 WP_003408180.1.23171 WP_003408180.1.23199 WP_003408180.1.2320 WP_003408180.1.23204 WP_003408180.1.23229 WP_003408180.1.23233 WP_003408180.1.2326 WP_003408180.1.23261 WP_003408180.1.23289 WP_003408180.1.2329 WP_003408180.1.23308 WP_003408180.1.23316 WP_003408180.1.23325 WP_003408180.1.2339 WP_003408180.1.23406 WP_003408180.1.23438 WP_003408180.1.23445 WP_003408180.1.23452 WP_003408180.1.23461 WP_003408180.1.2349 WP_003408180.1.23496 WP_003408180.1.23497 WP_003408180.1.23506 WP_003408180.1.23530 WP_003408180.1.23539 WP_003408180.1.23546 WP_003408180.1.23551 WP_003408180.1.23573 WP_003408180.1.23583 WP_003408180.1.23588 WP_003408180.1.23628 WP_003408180.1.23677 WP_003408180.1.23683 WP_003408180.1.23692 WP_003408180.1.23694 WP_003408180.1.23699 WP_003408180.1.2371 WP_003408180.1.23803 WP_003408180.1.23807 WP_003408180.1.23825 WP_003408180.1.23832 WP_003408180.1.2384 WP_003408180.1.23843 WP_003408180.1.23863 WP_003408180.1.2387 WP_003408180.1.23894 WP_003408180.1.23993 WP_003408180.1.2400 WP_003408180.1.24007 WP_003408180.1.24046 WP_003408180.1.24057 WP_003408180.1.24062 WP_003408180.1.24119 WP_003408180.1.24140 WP_003408180.1.24176 WP_003408180.1.24190 WP_003408180.1.24202 WP_003408180.1.24244 WP_003408180.1.24261 WP_003408180.1.24294 WP_003408180.1.24357 WP_003408180.1.24396 WP_003408180.1.2443 WP_003408180.1.24446 WP_003408180.1.24461 WP_003408180.1.24500 WP_003408180.1.24507 WP_003408180.1.24509 WP_003408180.1.24529 WP_003408180.1.24553 WP_003408180.1.24599 WP_003408180.1.24638 WP_003408180.1.24648 WP_003408180.1.24767 WP_003408180.1.24824 WP_003408180.1.24831 WP_003408180.1.24848 WP_003408180.1.24857 WP_003408180.1.2487 WP_003408180.1.24893 WP_003408180.1.24933 WP_003408180.1.24956 WP_003408180.1.24958 WP_003408180.1.2499 WP_003408180.1.25004 WP_003408180.1.2505 WP_003408180.1.25051 WP_003408180.1.2507 WP_003408180.1.25096 WP_003408180.1.25103 WP_003408180.1.25129 WP_003408180.1.25184 WP_003408180.1.25247 WP_003408180.1.25278 WP_003408180.1.25309 WP_003408180.1.25313 WP_003408180.1.25338 WP_003408180.1.25342 WP_003408180.1.25367 WP_003408180.1.25393 WP_003408180.1.25435 WP_003408180.1.25437 WP_003408180.1.25445 WP_003408180.1.25455 WP_003408180.1.25473 WP_003408180.1.25513 WP_003408180.1.25542 WP_003408180.1.25579 WP_003408180.1.25594 WP_003408180.1.25606 WP_003408180.1.2566 WP_003408180.1.25673 WP_003408180.1.25674 WP_003408180.1.25693 WP_003408180.1.25727 WP_003408180.1.25736 WP_003408180.1.25738 WP_003408180.1.25756 WP_003408180.1.25759 WP_003408180.1.2580 WP_003408180.1.25813 WP_003408180.1.25854 WP_003408180.1.25874 WP_003408180.1.25885 WP_003408180.1.25892 WP_003408180.1.25906 WP_003408180.1.25914 WP_003408180.1.25916 WP_003408180.1.2594 WP_003408180.1.25954 WP_003408180.1.25965 WP_003408180.1.25972 WP_003408180.1.26017 WP_003408180.1.26032 WP_003408180.1.26038 WP_003408180.1.26072 WP_003408180.1.26089 WP_003408180.1.26097 WP_003408180.1.26098 WP_003408180.1.26108 WP_003408180.1.26109 WP_003408180.1.26118 WP_003408180.1.26126 WP_003408180.1.2614 WP_003408180.1.26168 WP_003408180.1.26182 WP_003408180.1.26190 WP_003408180.1.2620 WP_003408180.1.26265 WP_003408180.1.26292 WP_003408180.1.26310 WP_003408180.1.26328 WP_003408180.1.26349 WP_003408180.1.26374 WP_003408180.1.26412 WP_003408180.1.26454 WP_003408180.1.26464 WP_003408180.1.26560 WP_003408180.1.26571 WP_003408180.1.2659 WP_003408180.1.26597 WP_003408180.1.26603 WP_003408180.1.26702 WP_003408180.1.26707 WP_003408180.1.26710 WP_003408180.1.26719 WP_003408180.1.26737 WP_003408180.1.26738 WP_003408180.1.26745 WP_003408180.1.2676 WP_003408180.1.2677 WP_003408180.1.26779 WP_003408180.1.26780 WP_003408180.1.26854 WP_003408180.1.26868 WP_003408180.1.26914 WP_003408180.1.26945 WP_003408180.1.26959 WP_003408180.1.26969 WP_003408180.1.26984 WP_003408180.1.26992 WP_003408180.1.27017 WP_003408180.1.27045 WP_003408180.1.27074 WP_003408180.1.27075 WP_003408180.1.27128 WP_003408180.1.27130 WP_003408180.1.27139 WP_003408180.1.27152 WP_003408180.1.27162 WP_003408180.1.27164 WP_003408180.1.27193 WP_003408180.1.27235 WP_003408180.1.27254 WP_003408180.1.27278 WP_003408180.1.27343 WP_003408180.1.27352 WP_003408180.1.27369 WP_003408180.1.27391 WP_003408180.1.27398 WP_003408180.1.27410 WP_003408180.1.27411 WP_003408180.1.27449 WP_003408180.1.27460 WP_003408180.1.27463 WP_003408180.1.27492 WP_003408180.1.27528 WP_003408180.1.27541 WP_003408180.1.27576 WP_003408180.1.27582 WP_003408180.1.27596 WP_003408180.1.27607 WP_003408180.1.2766 WP_003408180.1.277 WP_003408180.1.27724 WP_003408180.1.27730 WP_003408180.1.27736 WP_003408180.1.27743 WP_003408180.1.27750 WP_003408180.1.27771 WP_003408180.1.27779 WP_003408180.1.27795 WP_003408180.1.27819 WP_003408180.1.27835 WP_003408180.1.27915 WP_003408180.1.27935 WP_003408180.1.27962 WP_003408180.1.28053 WP_003408180.1.28092 WP_003408180.1.28106 WP_003408180.1.28131 WP_003408180.1.28142 WP_003408180.1.28159 WP_003408180.1.2816 WP_003408180.1.28161 WP_003408180.1.28192 WP_003408180.1.28202 WP_003408180.1.28241 WP_003408180.1.28255 WP_003408180.1.28269 WP_003408180.1.28293 WP_003408180.1.28331 WP_003408180.1.28367 WP_003408180.1.28378 WP_003408180.1.2842 WP_003408180.1.28448 WP_003408180.1.2847 WP_003408180.1.28471 WP_003408180.1.28473 WP_003408180.1.28493 WP_003408180.1.28497 WP_003408180.1.28530 WP_003408180.1.28545 WP_003408180.1.28561 WP_003408180.1.28567 WP_003408180.1.28585 WP_003408180.1.286 WP_003408180.1.28610 WP_003408180.1.28617 WP_003408180.1.28642 WP_003408180.1.28671 WP_003408180.1.28698 WP_003408180.1.28703 WP_003408180.1.28739 WP_003408180.1.28781 WP_003408180.1.28787 WP_003408180.1.28827 WP_003408180.1.28839 WP_003408180.1.28847 WP_003408180.1.28850 WP_003408180.1.28851 WP_003408180.1.28865 WP_003408180.1.28897 WP_003408180.1.28914 WP_003408180.1.28935 WP_003408180.1.28936 WP_003408180.1.28939 WP_003408180.1.28943 WP_003408180.1.28952 WP_003408180.1.28975 WP_003408180.1.2899 WP_003408180.1.28993 WP_003408180.1.29000 WP_003408180.1.2901 WP_003408180.1.29028 WP_003408180.1.29033 WP_003408180.1.29058 WP_003408180.1.29115 WP_003408180.1.2916 WP_003408180.1.29217 WP_003408180.1.29234 WP_003408180.1.29264 WP_003408180.1.29306 WP_003408180.1.29339 WP_003408180.1.29364 WP_003408180.1.29367 WP_003408180.1.2938 WP_003408180.1.29426 WP_003408180.1.2944 WP_003408180.1.29450 WP_003408180.1.29510 WP_003408180.1.29525 WP_003408180.1.2953 WP_003408180.1.29559 WP_003408180.1.29587 WP_003408180.1.2959 WP_003408180.1.29592 WP_003408180.1.29599 WP_003408180.1.29611 WP_003408180.1.29632 WP_003408180.1.29649 WP_003408180.1.2965 WP_003408180.1.29659 WP_003408180.1.2969 WP_003408180.1.29696 WP_003408180.1.29698 WP_003408180.1.29718 WP_003408180.1.29745 WP_003408180.1.29747 WP_003408180.1.29769 WP_003408180.1.29825 WP_003408180.1.29830 WP_003408180.1.29847 WP_003408180.1.29861 WP_003408180.1.29869 WP_003408180.1.29883 WP_003408180.1.29890 WP_003408180.1.299 WP_003408180.1.29931 WP_003408180.1.30014 WP_003408180.1.3004 WP_003408180.1.30040 WP_003408180.1.30043 WP_003408180.1.30074 WP_003408180.1.30097 WP_003408180.1.30106 WP_003408180.1.30114 WP_003408180.1.30126 WP_003408180.1.30131 WP_003408180.1.30139 WP_003408180.1.30145 WP_003408180.1.30211 WP_003408180.1.30235 WP_003408180.1.30237 WP_003408180.1.3027 WP_003408180.1.30279 WP_003408180.1.30282 WP_003408180.1.30283 WP_003408180.1.30288 WP_003408180.1.30291 WP_003408180.1.30363 WP_003408180.1.30374 WP_003408180.1.30404 WP_003408180.1.3043 WP_003408180.1.30433 WP_003408180.1.30438 WP_003408180.1.30462 WP_003408180.1.30464 WP_003408180.1.30468 WP_003408180.1.30500 WP_003408180.1.3057 WP_003408180.1.30574 WP_003408180.1.30628 WP_003408180.1.30641 WP_003408180.1.30642 WP_003408180.1.30661 WP_003408180.1.30669 WP_003408180.1.30683 WP_003408180.1.30699 WP_003408180.1.30709 WP_003408180.1.30713 WP_003408180.1.30716 WP_003408180.1.30719 WP_003408180.1.30730 WP_003408180.1.30732 WP_003408180.1.30736 WP_003408180.1.30760 WP_003408180.1.30791 WP_003408180.1.308 WP_003408180.1.30807 WP_003408180.1.30818 WP_003408180.1.30824 WP_003408180.1.30877 WP_003408180.1.30888 WP_003408180.1.30901 WP_003408180.1.30903 WP_003408180.1.30912 WP_003408180.1.30913 WP_003408180.1.30914 WP_003408180.1.30919 WP_003408180.1.30977 WP_003408180.1.3100 WP_003408180.1.31002 WP_003408180.1.3101 WP_003408180.1.31034 WP_003408180.1.31047 WP_003408180.1.31074 WP_003408180.1.31102 WP_003408180.1.31127 WP_003408180.1.31184 WP_003408180.1.31199 WP_003408180.1.31230 WP_003408180.1.31233 WP_003408180.1.31263 WP_003408180.1.31264 WP_003408180.1.31287 WP_003408180.1.31290 WP_003408180.1.31304 WP_003408180.1.31346 WP_003408180.1.31354 WP_003408180.1.31390 WP_003408180.1.31414 WP_003408180.1.31417 WP_003408180.1.31428 WP_003408180.1.3143 WP_003408180.1.31458 WP_003408180.1.31483 WP_003408180.1.3149 WP_003408180.1.31507 WP_003408180.1.31537 WP_003408180.1.31548 WP_003408180.1.31569 WP_003408180.1.31573 WP_003408180.1.316 WP_003408180.1.31629 WP_003408180.1.31666 WP_003408180.1.31693 WP_003408180.1.31703 WP_003408180.1.31744 WP_003408180.1.31745 WP_003408180.1.31770 WP_003408180.1.31776 WP_003408180.1.31783 WP_003408180.1.318 WP_003408180.1.3184 WP_003408180.1.31840 WP_003408180.1.31911 WP_003408180.1.31930 WP_003408180.1.31932 WP_003408180.1.31955 WP_003408180.1.31985 WP_003408180.1.31991 WP_003408180.1.31995 WP_003408180.1.32004 WP_003408180.1.32039 WP_003408180.1.3204 WP_003408180.1.32045 WP_003408180.1.32071 WP_003408180.1.32098 WP_003408180.1.32132 WP_003408180.1.32157 WP_003408180.1.32164 WP_003408180.1.32179 WP_003408180.1.32198 WP_003408180.1.32403 WP_003408180.1.32433 WP_003408180.1.32461 WP_003408180.1.32482 WP_003408180.1.32503 WP_003408180.1.32556 WP_003408180.1.32562 WP_003408180.1.32569 WP_003408180.1.32592 WP_003408180.1.32620 WP_003408180.1.32647 WP_003408180.1.32653 WP_003408180.1.32654 WP_003408180.1.3268 WP_003408180.1.32695 WP_003408180.1.32706 WP_003408180.1.32716 WP_003408180.1.32738 WP_003408180.1.32780 WP_003408180.1.32781 WP_003408180.1.32793 WP_003408180.1.32799 WP_003408180.1.32822 WP_003408180.1.32833 WP_003408180.1.32880 WP_003408180.1.32909 WP_003408180.1.32935 WP_003408180.1.32974 WP_003408180.1.33007 WP_003408180.1.3302 WP_003408180.1.33044 WP_003408180.1.33054 WP_003408180.1.33082 WP_003408180.1.33141 WP_003408180.1.33148 WP_003408180.1.33155 WP_003408180.1.3321 WP_003408180.1.33215 WP_003408180.1.3325 WP_003408180.1.3327 WP_003408180.1.33278 WP_003408180.1.33288 WP_003408180.1.33305 WP_003408180.1.3331 WP_003408180.1.33319 WP_003408180.1.3333 WP_003408180.1.33393 WP_003408180.1.33403 WP_003408180.1.33452 WP_003408180.1.33477 WP_003408180.1.3349 WP_003408180.1.33519 WP_003408180.1.33601 WP_003408180.1.33602 WP_003408180.1.33633 WP_003408180.1.33646 WP_003408180.1.33673 WP_003408180.1.3369 WP_003408180.1.33705 WP_003408180.1.33762 WP_003408180.1.33783 WP_003408180.1.33789 WP_003408180.1.3383 WP_003408180.1.33832 WP_003408180.1.33839 WP_003408180.1.33848 WP_003408180.1.3387 WP_003408180.1.33886 WP_003408180.1.33895 WP_003408180.1.33912 WP_003408180.1.33954 WP_003408180.1.3405 WP_003408180.1.34055 WP_003408180.1.34056 WP_003408180.1.34065 WP_003408180.1.3408 WP_003408180.1.34090 WP_003408180.1.34109 WP_003408180.1.34111 WP_003408180.1.34152 WP_003408180.1.34163 WP_003408180.1.34181 WP_003408180.1.34197 WP_003408180.1.34198 WP_003408180.1.34215 WP_003408180.1.34219 WP_003408180.1.34255 WP_003408180.1.34260 WP_003408180.1.34275 WP_003408180.1.343 WP_003408180.1.34347 WP_003408180.1.34358 WP_003408180.1.34392 WP_003408180.1.34428 WP_003408180.1.3443 WP_003408180.1.34435 WP_003408180.1.34446 WP_003408180.1.34499 WP_003408180.1.34505 WP_003408180.1.34516 WP_003408180.1.34551 WP_003408180.1.34563 WP_003408180.1.34576 WP_003408180.1.34581 WP_003408180.1.34588 WP_003408180.1.34596 WP_003408180.1.34599 WP_003408180.1.34639 WP_003408180.1.34673 WP_003408180.1.34724 WP_003408180.1.34740 WP_003408180.1.34755 WP_003408180.1.34777 WP_003408180.1.34783 WP_003408180.1.34841 WP_003408180.1.34919 WP_003408180.1.3492 WP_003408180.1.34933 WP_003408180.1.34945 WP_003408180.1.34946 WP_003408180.1.34954 WP_003408180.1.34960 WP_003408180.1.34961 WP_003408180.1.34963 WP_003408180.1.34965 WP_003408180.1.35023 WP_003408180.1.35072 WP_003408180.1.35100 WP_003408180.1.35156 WP_003408180.1.35160 WP_003408180.1.35162 WP_003408180.1.35176 WP_003408180.1.3520 WP_003408180.1.35213 WP_003408180.1.35221 WP_003408180.1.35246 WP_003408180.1.35278 WP_003408180.1.35301 WP_003408180.1.35311 WP_003408180.1.35312 WP_003408180.1.35317 WP_003408180.1.35319 WP_003408180.1.35347 WP_003408180.1.35363 WP_003408180.1.35382 WP_003408180.1.35426 WP_003408180.1.35439 WP_003408180.1.35455 WP_003408180.1.3548 WP_003408180.1.35484 WP_003408180.1.35492 WP_003408180.1.3553 WP_003408180.1.35553 WP_003408180.1.35555 WP_003408180.1.35561 WP_003408180.1.35602 WP_003408180.1.35635 WP_003408180.1.35657 WP_003408180.1.35687 WP_003408180.1.35707 WP_003408180.1.35732 WP_003408180.1.35754 WP_003408180.1.35767 WP_003408180.1.35770 WP_003408180.1.35771 WP_003408180.1.35780 WP_003408180.1.35805 WP_003408180.1.35821 WP_003408180.1.3584 WP_003408180.1.35848 WP_003408180.1.35874 WP_003408180.1.35876 WP_003408180.1.35899 WP_003408180.1.35954 WP_003408180.1.36005 WP_003408180.1.36014 WP_003408180.1.36023 WP_003408180.1.36051 WP_003408180.1.36053 WP_003408180.1.36075 WP_003408180.1.36089 WP_003408180.1.36097 WP_003408180.1.36098 WP_003408180.1.36116 WP_003408180.1.36145 WP_003408180.1.36205 WP_003408180.1.36228 WP_003408180.1.36246 WP_003408180.1.36252 WP_003408180.1.36260 WP_003408180.1.36303 WP_003408180.1.36309 WP_003408180.1.36315 WP_003408180.1.36319 WP_003408180.1.36326 WP_003408180.1.3634 WP_003408180.1.36356 WP_003408180.1.36357 WP_003408180.1.3636 WP_003408180.1.36385 WP_003408180.1.36399 WP_003408180.1.36436 WP_003408180.1.36465 WP_003408180.1.36469 WP_003408180.1.36508 WP_003408180.1.36540 WP_003408180.1.36561 WP_003408180.1.36571 WP_003408180.1.36573 WP_003408180.1.36578 WP_003408180.1.36585 WP_003408180.1.36597 WP_003408180.1.36614 WP_003408180.1.36657 WP_003408180.1.36674 WP_003408180.1.36727 WP_003408180.1.36733 WP_003408180.1.36810 WP_003408180.1.36862 WP_003408180.1.36893 WP_003408180.1.36901 WP_003408180.1.36921 WP_003408180.1.36935 WP_003408180.1.36941 WP_003408180.1.3695 WP_003408180.1.36968 WP_003408180.1.3700 WP_003408180.1.37004 WP_003408180.1.37012 WP_003408180.1.37131 WP_003408180.1.37157 WP_003408180.1.37175 WP_003408180.1.37188 WP_003408180.1.37213 WP_003408180.1.3724 WP_003408180.1.37277 WP_003408180.1.37305 WP_003408180.1.37330 WP_003408180.1.37389 WP_003408180.1.37400 WP_003408180.1.37440 WP_003408180.1.37459 WP_003408180.1.37468 WP_003408180.1.37475 WP_003408180.1.37484 WP_003408180.1.37601 WP_003408180.1.37612 WP_003408180.1.37632 WP_003408180.1.37643 WP_003408180.1.37655 WP_003408180.1.37660 WP_003408180.1.37674 WP_003408180.1.37700 WP_003408180.1.37701 WP_003408180.1.37709 WP_003408180.1.37711 WP_003408180.1.37721 WP_003408180.1.37722 WP_003408180.1.37747 WP_003408180.1.37765 WP_003408180.1.37772 WP_003408180.1.37804 WP_003408180.1.37809 WP_003408180.1.37859 WP_003408180.1.37877 WP_003408180.1.37912 WP_003408180.1.37913 WP_003408180.1.37950 WP_003408180.1.37973 WP_003408180.1.37975 WP_003408180.1.37983 WP_003408180.1.38 WP_003408180.1.38002 WP_003408180.1.3802 WP_003408180.1.38039 WP_003408180.1.38040 WP_003408180.1.38067 WP_003408180.1.38068 WP_003408180.1.38135 WP_003408180.1.38138 WP_003408180.1.38144 WP_003408180.1.38158 WP_003408180.1.38159 WP_003408180.1.38210 WP_003408180.1.38233 WP_003408180.1.38240 WP_003408180.1.38299 WP_003408180.1.38332 WP_003408180.1.38347 WP_003408180.1.38354 WP_003408180.1.38398 WP_003408180.1.38402 WP_003408180.1.38418 WP_003408180.1.38421 WP_003408180.1.38466 WP_003408180.1.38477 WP_003408180.1.38483 WP_003408180.1.385 WP_003408180.1.38530 WP_003408180.1.38594 WP_003408180.1.38601 WP_003408180.1.38611 WP_003408180.1.38639 WP_003408180.1.38646 WP_003408180.1.38648 WP_003408180.1.38654 WP_003408180.1.38660 WP_003408180.1.38671 WP_003408180.1.38672 WP_003408180.1.38677 WP_003408180.1.38750 WP_003408180.1.38772 WP_003408180.1.38812 WP_003408180.1.38821 WP_003408180.1.38844 WP_003408180.1.38863 WP_003408180.1.38873 WP_003408180.1.3889 WP_003408180.1.38894 WP_003408180.1.38909 WP_003408180.1.38939 WP_003408180.1.38974 WP_003408180.1.38975 WP_003408180.1.38991 WP_003408180.1.39025 WP_003408180.1.39070 WP_003408180.1.39072 WP_003408180.1.39095 WP_003408180.1.39174 WP_003408180.1.39176 WP_003408180.1.39178 WP_003408180.1.39190 WP_003408180.1.39201 WP_003408180.1.39207 WP_003408180.1.39236 WP_003408180.1.39239 WP_003408180.1.39252 WP_003408180.1.39288 WP_003408180.1.39295 WP_003408180.1.39306 WP_003408180.1.39359 WP_003408180.1.39364 WP_003408180.1.39447 WP_003408180.1.3945 WP_003408180.1.39455 WP_003408180.1.3949 WP_003408180.1.39521 WP_003408180.1.39560 WP_003408180.1.39592 WP_003408180.1.39593 WP_003408180.1.3960 WP_003408180.1.39616 WP_003408180.1.39654 WP_003408180.1.39657 WP_003408180.1.39661 WP_003408180.1.39674 WP_003408180.1.39678 WP_003408180.1.3971 WP_003408180.1.39728 WP_003408180.1.39739 WP_003408180.1.39748 WP_003408180.1.39751 WP_003408180.1.39759 WP_003408180.1.39801 WP_003408180.1.39848 WP_003408180.1.39877 WP_003408180.1.39925 WP_003408180.1.3994 WP_003408180.1.39959 WP_003408180.1.3996 WP_003408180.1.39960 WP_003408180.1.3997 WP_003408180.1.39980 WP_003408180.1.40000 WP_003408180.1.40028 WP_003408180.1.40094 WP_003408180.1.40096 WP_003408180.1.40150 WP_003408180.1.40156 WP_003408180.1.40174 WP_003408180.1.40186 WP_003408180.1.40276 WP_003408180.1.40277 WP_003408180.1.40323 WP_003408180.1.40336 WP_003408180.1.40353 WP_003408180.1.4036 WP_003408180.1.40402 WP_003408180.1.40413 WP_003408180.1.40446 WP_003408180.1.40451 WP_003408180.1.40455 WP_003408180.1.40523 WP_003408180.1.40543 WP_003408180.1.40641 WP_003408180.1.40646 WP_003408180.1.40651 WP_003408180.1.40653 WP_003408180.1.40705 WP_003408180.1.40723 WP_003408180.1.40735 WP_003408180.1.40876 WP_003408180.1.40881 WP_003408180.1.40922 WP_003408180.1.4095 WP_003408180.1.40956 WP_003408180.1.40957 WP_003408180.1.40964 WP_003408180.1.4097 WP_003408180.1.410 WP_003408180.1.41000 WP_003408180.1.41055 WP_003408180.1.41108 WP_003408180.1.41123 WP_003408180.1.41177 WP_003408180.1.41202 WP_003408180.1.41219 WP_003408180.1.41231 WP_003408180.1.41249 WP_003408180.1.4127 WP_003408180.1.41355 WP_003408180.1.41376 WP_003408180.1.41430 WP_003408180.1.41447 WP_003408180.1.41469 WP_003408180.1.41504 WP_003408180.1.41553 WP_003408180.1.41564 WP_003408180.1.41583 WP_003408180.1.41632 WP_003408180.1.41635 WP_003408180.1.41636 WP_003408180.1.41648 WP_003408180.1.41660 WP_003408180.1.41685 WP_003408180.1.41695 WP_003408180.1.41704 WP_003408180.1.4171 WP_003408180.1.41719 WP_003408180.1.41733 WP_003408180.1.41744 WP_003408180.1.41774 WP_003408180.1.41791 WP_003408180.1.41820 WP_003408180.1.41828 WP_003408180.1.41829 WP_003408180.1.41860 WP_003408180.1.41912 WP_003408180.1.41921 WP_003408180.1.41933 WP_003408180.1.41944 WP_003408180.1.42043 WP_003408180.1.42078 WP_003408180.1.42094 WP_003408180.1.42112 WP_003408180.1.4212 WP_003408180.1.42122 WP_003408180.1.42134 WP_003408180.1.42188 WP_003408180.1.42201 WP_003408180.1.42202 WP_003408180.1.42208 WP_003408180.1.42247 WP_003408180.1.42273 WP_003408180.1.42278 WP_003408180.1.42304 WP_003408180.1.42309 WP_003408180.1.42370 WP_003408180.1.42385 WP_003408180.1.42400 WP_003408180.1.42417 WP_003408180.1.42430 WP_003408180.1.42461 WP_003408180.1.42465 WP_003408180.1.42467 WP_003408180.1.42474 WP_003408180.1.4248 WP_003408180.1.42494 WP_003408180.1.42519 WP_003408180.1.42524 WP_003408180.1.42534 WP_003408180.1.4255 WP_003408180.1.42562 WP_003408180.1.42568 WP_003408180.1.42570 WP_003408180.1.42618 WP_003408180.1.42660 WP_003408180.1.42695 WP_003408180.1.42704 WP_003408180.1.42705 WP_003408180.1.42722 WP_003408180.1.42777 WP_003408180.1.42782 WP_003408180.1.42835 WP_003408180.1.42839 WP_003408180.1.42842 WP_003408180.1.42905 WP_003408180.1.42916 WP_003408180.1.42971 WP_003408180.1.43005 WP_003408180.1.43009 WP_003408180.1.43053 WP_003408180.1.43082 WP_003408180.1.43098 WP_003408180.1.43208 WP_003408180.1.43236 WP_003408180.1.43246 WP_003408180.1.43255 WP_003408180.1.43266 WP_003408180.1.43269 WP_003408180.1.43273 WP_003408180.1.43296 WP_003408180.1.43306 WP_003408180.1.43368 WP_003408180.1.43395 WP_003408180.1.43457 WP_003408180.1.43475 WP_003408180.1.43484 WP_003408180.1.43557 WP_003408180.1.43578 WP_003408180.1.43588 WP_003408180.1.43643 WP_003408180.1.43664 WP_003408180.1.43684 WP_003408180.1.43706 WP_003408180.1.43716 WP_003408180.1.4377 WP_003408180.1.43781 WP_003408180.1.43794 WP_003408180.1.43815 WP_003408180.1.43846 WP_003408180.1.43861 WP_003408180.1.43863 WP_003408180.1.43866 WP_003408180.1.43872 WP_003408180.1.43885 WP_003408180.1.43897 WP_003408180.1.4390 WP_003408180.1.43902 WP_003408180.1.43921 WP_003408180.1.43936 WP_003408180.1.43937 WP_003408180.1.43960 WP_003408180.1.4399 WP_003408180.1.43996 WP_003408180.1.44 WP_003408180.1.44001 WP_003408180.1.44008 WP_003408180.1.44016 WP_003408180.1.44033 WP_003408180.1.44037 WP_003408180.1.44070 WP_003408180.1.44071 WP_003408180.1.44076 WP_003408180.1.44104 WP_003408180.1.44124 WP_003408180.1.44219 WP_003408180.1.44277 WP_003408180.1.44279 WP_003408180.1.44336 WP_003408180.1.44355 WP_003408180.1.44358 WP_003408180.1.4438 WP_003408180.1.44390 WP_003408180.1.44392 WP_003408180.1.4441 WP_003408180.1.44415 WP_003408180.1.44466 WP_003408180.1.44492 WP_003408180.1.44500 WP_003408180.1.44532 WP_003408180.1.44534 WP_003408180.1.44562 WP_003408180.1.44597 WP_003408180.1.44600 WP_003408180.1.44602 WP_003408180.1.4464 WP_003408180.1.44651 WP_003408180.1.44659 WP_003408180.1.44665 WP_003408180.1.44694 WP_003408180.1.44700 WP_003408180.1.44735 WP_003408180.1.44740 WP_003408180.1.44757 WP_003408180.1.4476 WP_003408180.1.44776 WP_003408180.1.44779 WP_003408180.1.44786 WP_003408180.1.44808 WP_003408180.1.44901 WP_003408180.1.44908 WP_003408180.1.44913 WP_003408180.1.4492 WP_003408180.1.44939 WP_003408180.1.44979 WP_003408180.1.44981 WP_003408180.1.45002 WP_003408180.1.4504 WP_003408180.1.45081 WP_003408180.1.45113 WP_003408180.1.45129 WP_003408180.1.45135 WP_003408180.1.45147 WP_003408180.1.45168 WP_003408180.1.4517 WP_003408180.1.45181 WP_003408180.1.45185 WP_003408180.1.45192 WP_003408180.1.45200 WP_003408180.1.45205 WP_003408180.1.45211 WP_003408180.1.45249 WP_003408180.1.4526 WP_003408180.1.45286 WP_003408180.1.45326 WP_003408180.1.45374 WP_003408180.1.45390 WP_003408180.1.454 WP_003408180.1.45407 WP_003408180.1.45451 WP_003408180.1.45453 WP_003408180.1.45460 WP_003408180.1.45463 WP_003408180.1.45470 WP_003408180.1.45474 WP_003408180.1.45491 WP_003408180.1.45510 WP_003408180.1.45563 WP_003408180.1.45584 WP_003408180.1.45590 WP_003408180.1.45619 WP_003408180.1.45626 WP_003408180.1.45631 WP_003408180.1.45666 WP_003408180.1.45697 WP_003408180.1.4571 WP_003408180.1.45731 WP_003408180.1.45743 WP_003408180.1.45765 WP_003408180.1.45776 WP_003408180.1.45805 WP_003408180.1.45815 WP_003408180.1.45849 WP_003408180.1.4590 WP_003408180.1.45923 WP_003408180.1.45926 WP_003408180.1.45963 WP_003408180.1.45989 WP_003408180.1.45992 WP_003408180.1.46025 WP_003408180.1.46083 WP_003408180.1.46090 WP_003408180.1.46092 WP_003408180.1.46100 WP_003408180.1.46101 WP_003408180.1.46103 WP_003408180.1.46107 WP_003408180.1.46128 WP_003408180.1.46129 WP_003408180.1.46141 WP_003408180.1.46150 WP_003408180.1.46201 WP_003408180.1.46226 WP_003408180.1.4624 WP_003408180.1.46253 WP_003408180.1.46285 WP_003408180.1.46300 WP_003408180.1.46313 WP_003408180.1.46336 WP_003408180.1.46365 WP_003408180.1.46370 WP_003408180.1.46381 WP_003408180.1.46411 WP_003408180.1.4644 WP_003408180.1.46442 WP_003408180.1.46453 WP_003408180.1.46478 WP_003408180.1.46492 WP_003408180.1.4653 WP_003408180.1.46532 WP_003408180.1.46539 WP_003408180.1.46568 WP_003408180.1.46585 WP_003408180.1.46609 WP_003408180.1.46613 WP_003408180.1.46625 WP_003408180.1.46642 WP_003408180.1.46647 WP_003408180.1.46724 WP_003408180.1.46758 WP_003408180.1.46773 WP_003408180.1.46777 WP_003408180.1.46786 WP_003408180.1.46792 WP_003408180.1.46847 WP_003408180.1.46851 WP_003408180.1.4687 WP_003408180.1.46936 WP_003408180.1.46980 WP_003408180.1.47011 WP_003408180.1.47066 WP_003408180.1.47077 WP_003408180.1.47083 WP_003408180.1.47106 WP_003408180.1.47142 WP_003408180.1.47166 WP_003408180.1.47178 WP_003408180.1.47179 WP_003408180.1.47194 WP_003408180.1.47207 WP_003408180.1.47210 WP_003408180.1.47262 WP_003408180.1.47402 WP_003408180.1.47423 WP_003408180.1.47467 WP_003408180.1.47502 WP_003408180.1.4751 WP_003408180.1.47511 WP_003408180.1.47537 WP_003408180.1.47540 WP_003408180.1.47568 WP_003408180.1.47572 WP_003408180.1.47636 WP_003408180.1.4764 WP_003408180.1.47679 WP_003408180.1.47681 WP_003408180.1.47690 WP_003408180.1.4771 WP_003408180.1.47717 WP_003408180.1.47743 WP_003408180.1.47754 WP_003408180.1.47776 WP_003408180.1.47780 WP_003408180.1.47805 WP_003408180.1.47832 WP_003408180.1.47847 WP_003408180.1.47858 WP_003408180.1.47861 WP_003408180.1.47868 WP_003408180.1.47893 WP_003408180.1.47899 WP_003408180.1.479 WP_003408180.1.47912 WP_003408180.1.47913 WP_003408180.1.47926 WP_003408180.1.4794 WP_003408180.1.47943 WP_003408180.1.47944 WP_003408180.1.47959 WP_003408180.1.47974 WP_003408180.1.47993 WP_003408180.1.48004 WP_003408180.1.48039 WP_003408180.1.48050 WP_003408180.1.48084 WP_003408180.1.48097 WP_003408180.1.48101 WP_003408180.1.48109 WP_003408180.1.48130 WP_003408180.1.48135 WP_003408180.1.48143 WP_003408180.1.48152 WP_003408180.1.48155 WP_003408180.1.48170 WP_003408180.1.48177 WP_003408180.1.48185 WP_003408180.1.48204 WP_003408180.1.48219 WP_003408180.1.48240 WP_003408180.1.48256 WP_003408180.1.48264 WP_003408180.1.48287 WP_003408180.1.48333 WP_003408180.1.48348 WP_003408180.1.48354 WP_003408180.1.48372 WP_003408180.1.48383 WP_003408180.1.48388 WP_003408180.1.48419 WP_003408180.1.48423 WP_003408180.1.48443 WP_003408180.1.48462 WP_003408180.1.48543 WP_003408180.1.48550 WP_003408180.1.48605 WP_003408180.1.48618 WP_003408180.1.4863 WP_003408180.1.48648 WP_003408180.1.48658 WP_003408180.1.48666 WP_003408180.1.48687 WP_003408180.1.48779 WP_003408180.1.4878 WP_003408180.1.48798 WP_003408180.1.48802 WP_003408180.1.48826 WP_003408180.1.48831 WP_003408180.1.48843 WP_003408180.1.48857 WP_003408180.1.4890 WP_003408180.1.48946 WP_003408180.1.49017 WP_003408180.1.49048 WP_003408180.1.49059 WP_003408180.1.4907 WP_003408180.1.49103 WP_003408180.1.49110 WP_003408180.1.49112 WP_003408180.1.4919 WP_003408180.1.49251 WP_003408180.1.49254 WP_003408180.1.49263 WP_003408180.1.49291 WP_003408180.1.49296 WP_003408180.1.49335 WP_003408180.1.49337 WP_003408180.1.49419 WP_003408180.1.49426 WP_003408180.1.49437 WP_003408180.1.49439 WP_003408180.1.49474 WP_003408180.1.49506 WP_003408180.1.49523 WP_003408180.1.49526 WP_003408180.1.49532 WP_003408180.1.4959 WP_003408180.1.49678 WP_003408180.1.49687 WP_003408180.1.49699 WP_003408180.1.49709 WP_003408180.1.4971 WP_003408180.1.4972 WP_003408180.1.49736 WP_003408180.1.49746 WP_003408180.1.49764 WP_003408180.1.49773 WP_003408180.1.49796 WP_003408180.1.49814 WP_003408180.1.49815 WP_003408180.1.49816 WP_003408180.1.49839 WP_003408180.1.49857 WP_003408180.1.49878 WP_003408180.1.49944 WP_003408180.1.4999 WP_003408180.1.49990 WP_003408180.1.50068 WP_003408180.1.50077 WP_003408180.1.5008 WP_003408180.1.50081 WP_003408180.1.50122 WP_003408180.1.50149 WP_003408180.1.50162 WP_003408180.1.5018 WP_003408180.1.50218 WP_003408180.1.50235 WP_003408180.1.50249 WP_003408180.1.50265 WP_003408180.1.50271 WP_003408180.1.50324 WP_003408180.1.50347 WP_003408180.1.50372 WP_003408180.1.50407 WP_003408180.1.50444 WP_003408180.1.50466 WP_003408180.1.5048 WP_003408180.1.50498 WP_003408180.1.5050 WP_003408180.1.50554 WP_003408180.1.50557 WP_003408180.1.50601 WP_003408180.1.50610 WP_003408180.1.50632 WP_003408180.1.50633 WP_003408180.1.50655 WP_003408180.1.50683 WP_003408180.1.50692 WP_003408180.1.50714 WP_003408180.1.50729 WP_003408180.1.50756 WP_003408180.1.50784 WP_003408180.1.50794 WP_003408180.1.50860 WP_003408180.1.50868 WP_003408180.1.50877 WP_003408180.1.5096 WP_003408180.1.50981 WP_003408180.1.50987 WP_003408180.1.51003 WP_003408180.1.51009 WP_003408180.1.51037 WP_003408180.1.51074 WP_003408180.1.51082 WP_003408180.1.51149 WP_003408180.1.51156 WP_003408180.1.51157 WP_003408180.1.51213 WP_003408180.1.51232 WP_003408180.1.51239 WP_003408180.1.51247 WP_003408180.1.51291 WP_003408180.1.51294 WP_003408180.1.51301 WP_003408180.1.51391 WP_003408180.1.51445 WP_003408180.1.51455 WP_003408180.1.51466 WP_003408180.1.51468 WP_003408180.1.51478 WP_003408180.1.51497 WP_003408180.1.51520 WP_003408180.1.51593 WP_003408180.1.51628 WP_003408180.1.5164 WP_003408180.1.51647 WP_003408180.1.51696 WP_003408180.1.51721 WP_003408180.1.51788 WP_003408180.1.51795 WP_003408180.1.51801 WP_003408180.1.51817 WP_003408180.1.51819 WP_003408180.1.51854 WP_003408180.1.51923 WP_003408180.1.51942 WP_003408180.1.51948 WP_003408180.1.51963 WP_003408180.1.51969 WP_003408180.1.52000 WP_003408180.1.52001 WP_003408180.1.52003 WP_003408180.1.52006 WP_003408180.1.52036 WP_003408180.1.52046 WP_003408180.1.52059 WP_003408180.1.52069 WP_003408180.1.52082 WP_003408180.1.52102 WP_003408180.1.52106 WP_003408180.1.52166 WP_003408180.1.52168 WP_003408180.1.52173 WP_003408180.1.52178 WP_003408180.1.52206 WP_003408180.1.52216 WP_003408180.1.52238 WP_003408180.1.52241 WP_003408180.1.52314 WP_003408180.1.52385 WP_003408180.1.52390 WP_003408180.1.524 WP_003408180.1.52460 WP_003408180.1.52485 WP_003408180.1.52486 WP_003408180.1.52495 WP_003408180.1.52522 WP_003408180.1.52531 WP_003408180.1.52533 WP_003408180.1.52545 WP_003408180.1.52553 WP_003408180.1.52563 WP_003408180.1.52564 WP_003408180.1.52574 WP_003408180.1.52641 WP_003408180.1.52673 WP_003408180.1.52674 WP_003408180.1.52708 WP_003408180.1.52713 WP_003408180.1.52761 WP_003408180.1.52778 WP_003408180.1.52797 WP_003408180.1.52818 WP_003408180.1.52872 WP_003408180.1.52891 WP_003408180.1.52892 WP_003408180.1.52909 WP_003408180.1.52970 WP_003408180.1.52998 WP_003408180.1.53053 WP_003408180.1.53056 WP_003408180.1.5306 WP_003408180.1.5309 WP_003408180.1.531 WP_003408180.1.53117 WP_003408180.1.53118 WP_003408180.1.53142 WP_003408180.1.53143 WP_003408180.1.53157 WP_003408180.1.53167 WP_003408180.1.53200 WP_003408180.1.53213 WP_003408180.1.53217 WP_003408180.1.53226 WP_003408180.1.53229 WP_003408180.1.53230 WP_003408180.1.53237 WP_003408180.1.53254 WP_003408180.1.53257 WP_003408180.1.5327 WP_003408180.1.53276 WP_003408180.1.53278 WP_003408180.1.533 WP_003408180.1.53306 WP_003408180.1.5334 WP_003408180.1.5335 WP_003408180.1.53353 WP_003408180.1.53381 WP_003408180.1.53413 WP_003408180.1.53458 WP_003408180.1.53460 WP_003408180.1.53480 WP_003408180.1.53517 WP_003408180.1.53522 WP_003408180.1.53525 WP_003408180.1.53526 WP_003408180.1.53553 WP_003408180.1.53606 WP_003408180.1.53609 WP_003408180.1.53628 WP_003408180.1.53643 WP_003408180.1.53667 WP_003408180.1.53679 WP_003408180.1.53715 WP_003408180.1.53730 WP_003408180.1.53742 WP_003408180.1.53743 WP_003408180.1.53754 WP_003408180.1.53775 WP_003408180.1.53803 WP_003408180.1.53818 WP_003408180.1.53853 WP_003408180.1.53865 WP_003408180.1.53888 WP_003408180.1.53900 WP_003408180.1.53912 WP_003408180.1.53914 WP_003408180.1.53952 WP_003408180.1.5398 WP_003408180.1.5408 WP_003408180.1.54089 WP_003408180.1.54099 WP_003408180.1.54112 WP_003408180.1.54125 WP_003408180.1.54141 WP_003408180.1.54162 WP_003408180.1.54179 WP_003408180.1.54206 WP_003408180.1.54218 WP_003408180.1.54225 WP_003408180.1.54227 WP_003408180.1.54241 WP_003408180.1.54245 WP_003408180.1.54247 WP_003408180.1.54260 WP_003408180.1.54275 WP_003408180.1.54280 WP_003408180.1.5429 WP_003408180.1.54294 WP_003408180.1.54314 WP_003408180.1.54351 WP_003408180.1.54370 WP_003408180.1.54428 WP_003408180.1.54494 WP_003408180.1.54502 WP_003408180.1.54519 WP_003408180.1.5452 WP_003408180.1.54531 WP_003408180.1.54537 WP_003408180.1.54553 WP_003408180.1.54555 WP_003408180.1.54575 WP_003408180.1.54633 WP_003408180.1.54686 WP_003408180.1.54705 WP_003408180.1.54730 WP_003408180.1.54732 WP_003408180.1.5475 WP_003408180.1.54797 WP_003408180.1.54807 WP_003408180.1.54836 WP_003408180.1.54838 WP_003408180.1.54860 WP_003408180.1.54888 WP_003408180.1.54897 WP_003408180.1.54905 WP_003408180.1.54909 WP_003408180.1.54937 WP_003408180.1.54944 WP_003408180.1.54945 WP_003408180.1.54953 WP_003408180.1.54964 WP_003408180.1.55015 WP_003408180.1.55022 WP_003408180.1.55023 WP_003408180.1.55051 WP_003408180.1.55072 WP_003408180.1.55088 WP_003408180.1.55106 WP_003408180.1.55126 WP_003408180.1.55128 WP_003408180.1.55140 WP_003408180.1.55150 WP_003408180.1.55210 WP_003408180.1.55227 WP_003408180.1.55248 WP_003408180.1.55257 WP_003408180.1.55258 WP_003408180.1.55267 WP_003408180.1.55279 WP_003408180.1.55307 WP_003408180.1.55326 WP_003408180.1.55328 WP_003408180.1.55345 WP_003408180.1.55398 WP_003408180.1.55441 WP_003408180.1.55459 WP_003408180.1.55578 WP_003408180.1.55626 WP_003408180.1.55641 WP_003408180.1.5569 WP_003408180.1.55723 WP_003408180.1.55735 WP_003408180.1.5574 WP_003408180.1.55772 WP_003408180.1.55802 WP_003408180.1.55819 WP_003408180.1.55821 WP_003408180.1.5583 WP_003408180.1.55849 WP_003408180.1.55856 WP_003408180.1.55860 WP_003408180.1.55882 WP_003408180.1.55883 WP_003408180.1.55894 WP_003408180.1.55902 WP_003408180.1.55908 WP_003408180.1.55909 WP_003408180.1.5591 WP_003408180.1.55961 WP_003408180.1.55977 WP_003408180.1.55983 WP_003408180.1.56028 WP_003408180.1.56057 WP_003408180.1.56060 WP_003408180.1.56107 WP_003408180.1.56132 WP_003408180.1.56163 WP_003408180.1.56167 WP_003408180.1.56178 WP_003408180.1.56287 WP_003408180.1.56292 WP_003408180.1.56327 WP_003408180.1.56341 WP_003408180.1.56359 WP_003408180.1.56394 WP_003408180.1.56443 WP_003408180.1.56473 WP_003408180.1.56478 WP_003408180.1.56500 WP_003408180.1.56517 WP_003408180.1.5656 WP_003408180.1.56577 WP_003408180.1.56593 WP_003408180.1.56625 WP_003408180.1.56637 WP_003408180.1.56670 WP_003408180.1.567 WP_003408180.1.56701 WP_003408180.1.56729 WP_003408180.1.56743 WP_003408180.1.56755 WP_003408180.1.56764 WP_003408180.1.56769 WP_003408180.1.56795 WP_003408180.1.5681 WP_003408180.1.56827 WP_003408180.1.56839 WP_003408180.1.56863 WP_003408180.1.56868 WP_003408180.1.56869 WP_003408180.1.56915 WP_003408180.1.56926 WP_003408180.1.56961 WP_003408180.1.56972 WP_003408180.1.57023 WP_003408180.1.57035 WP_003408180.1.57077 WP_003408180.1.57087 WP_003408180.1.57094 WP_003408180.1.57134 WP_003408180.1.57169 WP_003408180.1.57208 WP_003408180.1.57212 WP_003408180.1.57230 WP_003408180.1.5724 WP_003408180.1.5725 WP_003408180.1.5727 WP_003408180.1.57273 WP_003408180.1.57326 WP_003408180.1.57328 WP_003408180.1.57331 WP_003408180.1.57340 WP_003408180.1.57351 WP_003408180.1.57380 WP_003408180.1.5744 WP_003408180.1.57440 WP_003408180.1.5745 WP_003408180.1.57461 WP_003408180.1.57469 WP_003408180.1.57489 WP_003408180.1.575 WP_003408180.1.57509 WP_003408180.1.57519 WP_003408180.1.57525 WP_003408180.1.57551 WP_003408180.1.57596 WP_003408180.1.57604 WP_003408180.1.57616 WP_003408180.1.57619 WP_003408180.1.57627 WP_003408180.1.57642 WP_003408180.1.57667 WP_003408180.1.57675 WP_003408180.1.57794 WP_003408180.1.57821 WP_003408180.1.57825 WP_003408180.1.57843 WP_003408180.1.57906 WP_003408180.1.57924 WP_003408180.1.57926 WP_003408180.1.57957 WP_003408180.1.57960 WP_003408180.1.57964 WP_003408180.1.57991 WP_003408180.1.58000 WP_003408180.1.58086 WP_003408180.1.58101 WP_003408180.1.58103 WP_003408180.1.58108 WP_003408180.1.5811 WP_003408180.1.58121 WP_003408180.1.58145 WP_003408180.1.58164 WP_003408180.1.58174 WP_003408180.1.582 WP_003408180.1.58209 WP_003408180.1.58215 WP_003408180.1.5824 WP_003408180.1.58250 WP_003408180.1.58283 WP_003408180.1.58288 WP_003408180.1.5830 WP_003408180.1.58303 WP_003408180.1.58311 WP_003408180.1.58330 WP_003408180.1.58359 WP_003408180.1.58386 WP_003408180.1.58393 WP_003408180.1.58431 WP_003408180.1.5844 WP_003408180.1.58457 WP_003408180.1.58488 WP_003408180.1.58518 WP_003408180.1.58534 WP_003408180.1.58559 WP_003408180.1.58567 WP_003408180.1.58573 WP_003408180.1.58602 WP_003408180.1.58612 WP_003408180.1.58619 WP_003408180.1.58630 WP_003408180.1.5865 WP_003408180.1.58671 WP_003408180.1.58690 WP_003408180.1.58702 WP_003408180.1.58743 WP_003408180.1.58754 WP_003408180.1.5879 WP_003408180.1.5881 WP_003408180.1.58848 WP_003408180.1.58857 WP_003408180.1.58892 WP_003408180.1.5890 WP_003408180.1.58921 WP_003408180.1.58930 WP_003408180.1.58953 WP_003408180.1.58961 WP_003408180.1.5898 WP_003408180.1.59025 WP_003408180.1.59029 WP_003408180.1.59037 WP_003408180.1.59044 WP_003408180.1.59088 WP_003408180.1.59112 WP_003408180.1.59130 WP_003408180.1.5914 WP_003408180.1.59147 WP_003408180.1.59166 WP_003408180.1.59205 WP_003408180.1.59209 WP_003408180.1.59237 WP_003408180.1.59240 WP_003408180.1.59253 WP_003408180.1.59254 WP_003408180.1.59262 WP_003408180.1.59270 WP_003408180.1.5928 WP_003408180.1.59304 WP_003408180.1.59305 WP_003408180.1.59309 WP_003408180.1.59333 WP_003408180.1.59338 WP_003408180.1.59388 WP_003408180.1.59428 WP_003408180.1.59487 WP_003408180.1.59537 WP_003408180.1.59561 WP_003408180.1.59722 WP_003408180.1.59727 WP_003408180.1.59732 WP_003408180.1.59738 WP_003408180.1.59750 WP_003408180.1.59757 WP_003408180.1.59761 WP_003408180.1.59808 WP_003408180.1.59850 WP_003408180.1.59860 WP_003408180.1.59861 WP_003408180.1.5987 WP_003408180.1.59878 WP_003408180.1.59888 WP_003408180.1.59952 WP_003408180.1.5996 WP_003408180.1.59961 WP_003408180.1.59974 WP_003408180.1.6000 WP_003408180.1.6003 WP_003408180.1.60047 WP_003408180.1.6007 WP_003408180.1.60121 WP_003408180.1.60125 WP_003408180.1.60135 WP_003408180.1.60139 WP_003408180.1.60152 WP_003408180.1.60171 WP_003408180.1.60197 WP_003408180.1.6020 WP_003408180.1.60205 WP_003408180.1.60207 WP_003408180.1.60215 WP_003408180.1.60217 WP_003408180.1.60267 WP_003408180.1.60288 WP_003408180.1.60291 WP_003408180.1.60301 WP_003408180.1.60312 WP_003408180.1.60313 WP_003408180.1.60314 WP_003408180.1.60367 WP_003408180.1.60376 WP_003408180.1.60403 WP_003408180.1.60413 WP_003408180.1.60421 WP_003408180.1.60451 WP_003408180.1.60460 WP_003408180.1.60512 WP_003408180.1.60573 WP_003408180.1.60583 WP_003408180.1.60632 WP_003408180.1.60657 WP_003408180.1.60689 WP_003408180.1.60727 WP_003408180.1.60738 WP_003408180.1.60763 WP_003408180.1.6077 WP_003408180.1.60791 WP_003408180.1.60834 WP_003408180.1.60878 WP_003408180.1.60879 WP_003408180.1.60913 WP_003408180.1.60978 WP_003408180.1.61000 WP_003408180.1.61001 WP_003408180.1.61012 WP_003408180.1.61014 WP_003408180.1.61015 WP_003408180.1.61037 WP_003408180.1.61052 WP_003408180.1.61065 WP_003408180.1.61100 WP_003408180.1.61101 WP_003408180.1.61138 WP_003408180.1.61142 WP_003408180.1.61198 WP_003408180.1.612 WP_003408180.1.61234 WP_003408180.1.61256 WP_003408180.1.61281 WP_003408180.1.61314 WP_003408180.1.61321 WP_003408180.1.61326 WP_003408180.1.61328 WP_003408180.1.61368 WP_003408180.1.61391 WP_003408180.1.61406 WP_003408180.1.61409 WP_003408180.1.61420 WP_003408180.1.61422 WP_003408180.1.61425 WP_003408180.1.61428 WP_003408180.1.61469 WP_003408180.1.61522 WP_003408180.1.61552 WP_003408180.1.61557 WP_003408180.1.61571 WP_003408180.1.61573 WP_003408180.1.61584 WP_003408180.1.61586 WP_003408180.1.6159 WP_003408180.1.61592 WP_003408180.1.6160 WP_003408180.1.61614 WP_003408180.1.6163 WP_003408180.1.61655 WP_003408180.1.61665 WP_003408180.1.61669 WP_003408180.1.61682 WP_003408180.1.61692 WP_003408180.1.61719 WP_003408180.1.61728 WP_003408180.1.61750 WP_003408180.1.61754 WP_003408180.1.61755 WP_003408180.1.61757 WP_003408180.1.61778 WP_003408180.1.6179 WP_003408180.1.61793 WP_003408180.1.61816 WP_003408180.1.61842 WP_003408180.1.61850 WP_003408180.1.61862 WP_003408180.1.61865 WP_003408180.1.61911 WP_003408180.1.61925 WP_003408180.1.61953 WP_003408180.1.61987 WP_003408180.1.62021 WP_003408180.1.62087 WP_003408180.1.62089 WP_003408180.1.62101 WP_003408180.1.6211 WP_003408180.1.62132 WP_003408180.1.62162 WP_003408180.1.62225 WP_003408180.1.62230 WP_003408180.1.62238 WP_003408180.1.62249 WP_003408180.1.62270 WP_003408180.1.62281 WP_003408180.1.62307 WP_003408180.1.6231 WP_003408180.1.62359 WP_003408180.1.62360 WP_003408180.1.62371 WP_003408180.1.62379 WP_003408180.1.62395 WP_003408180.1.62449 WP_003408180.1.62468 WP_003408180.1.6248 WP_003408180.1.62508 WP_003408180.1.62565 WP_003408180.1.62594 WP_003408180.1.62606 WP_003408180.1.62616 WP_003408180.1.62666 WP_003408180.1.62687 WP_003408180.1.62715 WP_003408180.1.62730 WP_003408180.1.62761 WP_003408180.1.62766 WP_003408180.1.62839 WP_003408180.1.62841 WP_003408180.1.62936 WP_003408180.1.6294 WP_003408180.1.6295 WP_003408180.1.62962 WP_003408180.1.63019 WP_003408180.1.63032 WP_003408180.1.63037 WP_003408180.1.63064 WP_003408180.1.63066 WP_003408180.1.63072 WP_003408180.1.6308 WP_003408180.1.63081 WP_003408180.1.63106 WP_003408180.1.63144 WP_003408180.1.63160 WP_003408180.1.63161 WP_003408180.1.63175 WP_003408180.1.63194 WP_003408180.1.63222 WP_003408180.1.6328 WP_003408180.1.63291 WP_003408180.1.63331 WP_003408180.1.63384 WP_003408180.1.63403 WP_003408180.1.63424 WP_003408180.1.6345 WP_003408180.1.63464 WP_003408180.1.63483 WP_003408180.1.63502 WP_003408180.1.63504 WP_003408180.1.63522 WP_003408180.1.63530 WP_003408180.1.63564 WP_003408180.1.63567 WP_003408180.1.63596 WP_003408180.1.63600 WP_003408180.1.63623 WP_003408180.1.63625 WP_003408180.1.63627 WP_003408180.1.63654 WP_003408180.1.63662 WP_003408180.1.63711 WP_003408180.1.63734 WP_003408180.1.63807 WP_003408180.1.63819 WP_003408180.1.63844 WP_003408180.1.63888 WP_003408180.1.63913 WP_003408180.1.63915 WP_003408180.1.63918 WP_003408180.1.63970 WP_003408180.1.64000 WP_003408180.1.64027 WP_003408180.1.64058 WP_003408180.1.64065 WP_003408180.1.6407 WP_003408180.1.64082 WP_003408180.1.64091 WP_003408180.1.64102 WP_003408180.1.64104 WP_003408180.1.64169 WP_003408180.1.64219 WP_003408180.1.6422 WP_003408180.1.64222 WP_003408180.1.64228 WP_003408180.1.64235 WP_003408180.1.64249 WP_003408180.1.6427 WP_003408180.1.64278 WP_003408180.1.64287 WP_003408180.1.64414 WP_003408180.1.64419 WP_003408180.1.6443 WP_003408180.1.64463 WP_003408180.1.64480 WP_003408180.1.64497 WP_003408180.1.64506 WP_003408180.1.64511 WP_003408180.1.64513 WP_003408180.1.64515 WP_003408180.1.64522 WP_003408180.1.64526 WP_003408180.1.64543 WP_003408180.1.6456 WP_003408180.1.64567 WP_003408180.1.64588 WP_003408180.1.64589 WP_003408180.1.64594 WP_003408180.1.64595 WP_003408180.1.64608 WP_003408180.1.64619 WP_003408180.1.64629 WP_003408180.1.6464 WP_003408180.1.64664 WP_003408180.1.64669 WP_003408180.1.64672 WP_003408180.1.64680 WP_003408180.1.64682 WP_003408180.1.64727 WP_003408180.1.64729 WP_003408180.1.64774 WP_003408180.1.64776 WP_003408180.1.64832 WP_003408180.1.6486 WP_003408180.1.64870 WP_003408180.1.64898 WP_003408180.1.64922 WP_003408180.1.64924 WP_003408180.1.6493 WP_003408180.1.64941 WP_003408180.1.64966 WP_003408180.1.64973 WP_003408180.1.65001 WP_003408180.1.65026 WP_003408180.1.65053 WP_003408180.1.65070 WP_003408180.1.65079 WP_003408180.1.65102 WP_003408180.1.65157 WP_003408180.1.65229 WP_003408180.1.6523 WP_003408180.1.65253 WP_003408180.1.65289 WP_003408180.1.65291 WP_003408180.1.65315 WP_003408180.1.65329 WP_003408180.1.65359 WP_003408180.1.6536 WP_003408180.1.65374 WP_003408180.1.65414 WP_003408180.1.65416 WP_003408180.1.65433 WP_003408180.1.65455 WP_003408180.1.65467 WP_003408180.1.65488 WP_003408180.1.65529 WP_003408180.1.65539 WP_003408180.1.65583 WP_003408180.1.65612 WP_003408180.1.65623 WP_003408180.1.65635 WP_003408180.1.65637 WP_003408180.1.65648 WP_003408180.1.65683 WP_003408180.1.65688 WP_003408180.1.65707 WP_003408180.1.65733 WP_003408180.1.65746 WP_003408180.1.65747 WP_003408180.1.65759 WP_003408180.1.65816 WP_003408180.1.65830 WP_003408180.1.65858 WP_003408180.1.65862 WP_003408180.1.65869 WP_003408180.1.65893 WP_003408180.1.65929 WP_003408180.1.65932 WP_003408180.1.65958 WP_003408180.1.65974 WP_003408180.1.66004 WP_003408180.1.66013 WP_003408180.1.6606 WP_003408180.1.66089 WP_003408180.1.66151 WP_003408180.1.66276 WP_003408180.1.66293 WP_003408180.1.66297 WP_003408180.1.66323 WP_003408180.1.66325 WP_003408180.1.6633 WP_003408180.1.66334 WP_003408180.1.66355 WP_003408180.1.66367 WP_003408180.1.66394 WP_003408180.1.66396 WP_003408180.1.66451 WP_003408180.1.66455 WP_003408180.1.66457 WP_003408180.1.66460 WP_003408180.1.66464 WP_003408180.1.66466 WP_003408180.1.66487 WP_003408180.1.66504 WP_003408180.1.66544 WP_003408180.1.66580 WP_003408180.1.66582 WP_003408180.1.66612 WP_003408180.1.66617 WP_003408180.1.66635 WP_003408180.1.66656 WP_003408180.1.66663 WP_003408180.1.66675 WP_003408180.1.66715 WP_003408180.1.66718 WP_003408180.1.66762 WP_003408180.1.66776 WP_003408180.1.66808 WP_003408180.1.66817 WP_003408180.1.66819 WP_003408180.1.66826 WP_003408180.1.66830 WP_003408180.1.66842 WP_003408180.1.66878 WP_003408180.1.66880 WP_003408180.1.66893 WP_003408180.1.66961 WP_003408180.1.67005 WP_003408180.1.6704 WP_003408180.1.67044 WP_003408180.1.67061 WP_003408180.1.67089 WP_003408180.1.67098 WP_003408180.1.67146 WP_003408180.1.67197 WP_003408180.1.67198 WP_003408180.1.6720 WP_003408180.1.67207 WP_003408180.1.67218 WP_003408180.1.67220 WP_003408180.1.67225 WP_003408180.1.67231 WP_003408180.1.6724 WP_003408180.1.67298 WP_003408180.1.67307 WP_003408180.1.67324 WP_003408180.1.67332 WP_003408180.1.67346 WP_003408180.1.67360 WP_003408180.1.67381 WP_003408180.1.67396 WP_003408180.1.67417 WP_003408180.1.67453 WP_003408180.1.67459 WP_003408180.1.6746 WP_003408180.1.67473 WP_003408180.1.67482 WP_003408180.1.67496 WP_003408180.1.67499 WP_003408180.1.67523 WP_003408180.1.67536 WP_003408180.1.67575 WP_003408180.1.67587 WP_003408180.1.67598 WP_003408180.1.67600 WP_003408180.1.67602 WP_003408180.1.67630 WP_003408180.1.67679 WP_003408180.1.67692 WP_003408180.1.67744 WP_003408180.1.6775 WP_003408180.1.6777 WP_003408180.1.67809 WP_003408180.1.67816 WP_003408180.1.67844 WP_003408180.1.67848 WP_003408180.1.67870 WP_003408180.1.67888 WP_003408180.1.67915 WP_003408180.1.67945 WP_003408180.1.67949 WP_003408180.1.67980 WP_003408180.1.68022 WP_003408180.1.68029 WP_003408180.1.68037 WP_003408180.1.68038 WP_003408180.1.68045 WP_003408180.1.68057 WP_003408180.1.68083 WP_003408180.1.68088 WP_003408180.1.68106 WP_003408180.1.68110 WP_003408180.1.68169 WP_003408180.1.68193 WP_003408180.1.68212 WP_003408180.1.68243 WP_003408180.1.6825 WP_003408180.1.68297 WP_003408180.1.68309 WP_003408180.1.68325 WP_003408180.1.68329 WP_003408180.1.68340 WP_003408180.1.68384 WP_003408180.1.68388 WP_003408180.1.68429 WP_003408180.1.68433 WP_003408180.1.68444 WP_003408180.1.68465 WP_003408180.1.68518 WP_003408180.1.68569 WP_003408180.1.68576 WP_003408180.1.68586 WP_003408180.1.68637 WP_003408180.1.68646 WP_003408180.1.68667 WP_003408180.1.68669 WP_003408180.1.68672 WP_003408180.1.68684 WP_003408180.1.68704 WP_003408180.1.68708 WP_003408180.1.6872 WP_003408180.1.68730 WP_003408180.1.68734 WP_003408180.1.68748 WP_003408180.1.68754 WP_003408180.1.6876 WP_003408180.1.68761 WP_003408180.1.68766 WP_003408180.1.68774 WP_003408180.1.68796 WP_003408180.1.68824 WP_003408180.1.68832 WP_003408180.1.68841 WP_003408180.1.68859 WP_003408180.1.68876 WP_003408180.1.68906 WP_003408180.1.68916 WP_003408180.1.68923 WP_003408180.1.68945 WP_003408180.1.6896 WP_003408180.1.68981 WP_003408180.1.68984 WP_003408180.1.68997 WP_003408180.1.69076 WP_003408180.1.69079 WP_003408180.1.6908 WP_003408180.1.69082 WP_003408180.1.69178 WP_003408180.1.69181 WP_003408180.1.69208 WP_003408180.1.69231 WP_003408180.1.69256 WP_003408180.1.69311 WP_003408180.1.69315 WP_003408180.1.69322 WP_003408180.1.69342 WP_003408180.1.6935 WP_003408180.1.6936 WP_003408180.1.69369 WP_003408180.1.69374 WP_003408180.1.69398 WP_003408180.1.69426 WP_003408180.1.69427 WP_003408180.1.69429 WP_003408180.1.6949 WP_003408180.1.6951 WP_003408180.1.69511 WP_003408180.1.69526 WP_003408180.1.69528 WP_003408180.1.69547 WP_003408180.1.69573 WP_003408180.1.69581 WP_003408180.1.6960 WP_003408180.1.69617 WP_003408180.1.69634 WP_003408180.1.69647 WP_003408180.1.69659 WP_003408180.1.69673 WP_003408180.1.69682 WP_003408180.1.69684 WP_003408180.1.69686 WP_003408180.1.69707 WP_003408180.1.69709 WP_003408180.1.69736 WP_003408180.1.69778 WP_003408180.1.69800 WP_003408180.1.69802 WP_003408180.1.69845 WP_003408180.1.69870 WP_003408180.1.69873 WP_003408180.1.69898 WP_003408180.1.69913 WP_003408180.1.69931 WP_003408180.1.69938 WP_003408180.1.69955 WP_003408180.1.69957 WP_003408180.1.69981 WP_003408180.1.69990 WP_003408180.1.70 WP_003408180.1.70000 WP_003408180.1.70017 WP_003408180.1.70032 WP_003408180.1.70062 WP_003408180.1.70072 WP_003408180.1.70131 WP_003408180.1.70132 WP_003408180.1.7022 WP_003408180.1.70227 WP_003408180.1.70255 WP_003408180.1.70271 WP_003408180.1.70274 WP_003408180.1.7029 WP_003408180.1.70325 WP_003408180.1.70328 WP_003408180.1.70364 WP_003408180.1.70368 WP_003408180.1.70369 WP_003408180.1.70418 WP_003408180.1.70422 WP_003408180.1.70435 WP_003408180.1.70444 WP_003408180.1.70463 WP_003408180.1.70471 WP_003408180.1.70480 WP_003408180.1.70498 WP_003408180.1.70505 WP_003408180.1.70525 WP_003408180.1.70577 WP_003408180.1.70610 WP_003408180.1.70615 WP_003408180.1.70618 WP_003408180.1.70622 WP_003408180.1.70626 WP_003408180.1.70668 WP_003408180.1.70699 WP_003408180.1.70704 WP_003408180.1.70729 WP_003408180.1.70757 WP_003408180.1.70782 WP_003408180.1.70830 WP_003408180.1.70834 WP_003408180.1.7084 WP_003408180.1.70840 WP_003408180.1.70864 WP_003408180.1.70871 WP_003408180.1.70915 WP_003408180.1.70958 WP_003408180.1.70976 WP_003408180.1.71015 WP_003408180.1.71063 WP_003408180.1.71076 WP_003408180.1.71083 WP_003408180.1.7111 WP_003408180.1.71118 WP_003408180.1.71128 WP_003408180.1.7113 WP_003408180.1.71187 WP_003408180.1.71191 WP_003408180.1.71255 WP_003408180.1.71258 WP_003408180.1.71259 WP_003408180.1.71289 WP_003408180.1.71326 WP_003408180.1.71329 WP_003408180.1.71331 WP_003408180.1.71344 WP_003408180.1.71390 WP_003408180.1.71414 WP_003408180.1.71457 WP_003408180.1.7146 WP_003408180.1.71464 WP_003408180.1.71490 WP_003408180.1.71509 WP_003408180.1.71517 WP_003408180.1.71527 WP_003408180.1.71532 WP_003408180.1.71545 WP_003408180.1.71546 WP_003408180.1.71630 WP_003408180.1.71638 WP_003408180.1.71654 WP_003408180.1.71664 WP_003408180.1.71665 WP_003408180.1.71683 WP_003408180.1.71701 WP_003408180.1.71718 WP_003408180.1.71731 WP_003408180.1.71778 WP_003408180.1.71803 WP_003408180.1.71820 WP_003408180.1.71847 WP_003408180.1.7185 WP_003408180.1.71851 WP_003408180.1.71871 WP_003408180.1.71909 WP_003408180.1.71957 WP_003408180.1.71970 WP_003408180.1.72047 WP_003408180.1.72061 WP_003408180.1.72062 WP_003408180.1.72072 WP_003408180.1.72111 WP_003408180.1.72122 WP_003408180.1.72143 WP_003408180.1.72168 WP_003408180.1.72179 WP_003408180.1.72209 WP_003408180.1.72218 WP_003408180.1.72219 WP_003408180.1.72227 WP_003408180.1.7224 WP_003408180.1.72268 WP_003408180.1.72332 WP_003408180.1.72380 WP_003408180.1.72401 WP_003408180.1.72405 WP_003408180.1.72420 WP_003408180.1.72441 WP_003408180.1.72451 WP_003408180.1.72452 WP_003408180.1.72457 WP_003408180.1.72459 WP_003408180.1.72460 WP_003408180.1.72466 WP_003408180.1.72487 WP_003408180.1.72488 WP_003408180.1.72492 WP_003408180.1.72506 WP_003408180.1.72543 WP_003408180.1.7256 WP_003408180.1.72576 WP_003408180.1.72578 WP_003408180.1.72585 WP_003408180.1.72591 WP_003408180.1.72592 WP_003408180.1.72640 WP_003408180.1.7266 WP_003408180.1.72661 WP_003408180.1.72684 WP_003408180.1.72739 WP_003408180.1.72744 WP_003408180.1.72755 WP_003408180.1.72784 WP_003408180.1.72792 WP_003408180.1.72826 WP_003408180.1.72831 WP_003408180.1.72852 WP_003408180.1.72853 WP_003408180.1.72879 WP_003408180.1.72938 WP_003408180.1.72954 WP_003408180.1.72957 WP_003408180.1.72959 WP_003408180.1.72982 WP_003408180.1.72988 WP_003408180.1.72993 WP_003408180.1.73006 WP_003408180.1.73013 WP_003408180.1.73025 WP_003408180.1.73028 WP_003408180.1.73042 WP_003408180.1.73045 WP_003408180.1.73092 WP_003408180.1.73118 WP_003408180.1.7312 WP_003408180.1.73127 WP_003408180.1.73134 WP_003408180.1.73154 WP_003408180.1.73163 WP_003408180.1.73182 WP_003408180.1.73205 WP_003408180.1.7321 WP_003408180.1.73310 WP_003408180.1.73365 WP_003408180.1.73391 WP_003408180.1.73404 WP_003408180.1.73424 WP_003408180.1.73436 WP_003408180.1.73445 WP_003408180.1.73453 WP_003408180.1.73466 WP_003408180.1.73470 WP_003408180.1.73471 WP_003408180.1.73478 WP_003408180.1.73482 WP_003408180.1.73507 WP_003408180.1.73532 WP_003408180.1.73550 WP_003408180.1.73629 WP_003408180.1.73644 WP_003408180.1.7366 WP_003408180.1.73661 WP_003408180.1.7368 WP_003408180.1.73688 WP_003408180.1.73723 WP_003408180.1.73744 WP_003408180.1.73750 WP_003408180.1.73760 WP_003408180.1.73774 WP_003408180.1.7379 WP_003408180.1.73813 WP_003408180.1.73840 WP_003408180.1.73876 WP_003408180.1.7389 WP_003408180.1.74016 WP_003408180.1.74083 WP_003408180.1.74101 WP_003408180.1.74129 WP_003408180.1.74144 WP_003408180.1.7417 WP_003408180.1.74190 WP_003408180.1.74210 WP_003408180.1.7423 WP_003408180.1.74259 WP_003408180.1.74262 WP_003408180.1.74269 WP_003408180.1.74282 WP_003408180.1.74291 WP_003408180.1.74296 WP_003408180.1.74304 WP_003408180.1.7432 WP_003408180.1.74347 WP_003408180.1.7436 WP_003408180.1.74378 WP_003408180.1.74382 WP_003408180.1.74395 WP_003408180.1.74400 WP_003408180.1.74432 WP_003408180.1.74442 WP_003408180.1.74477 WP_003408180.1.74487 WP_003408180.1.74499 WP_003408180.1.74504 WP_003408180.1.74511 WP_003408180.1.74523 WP_003408180.1.74525 WP_003408180.1.74551 WP_003408180.1.74555 WP_003408180.1.74628 WP_003408180.1.74641 WP_003408180.1.74653 WP_003408180.1.74683 WP_003408180.1.7469 WP_003408180.1.74725 WP_003408180.1.74760 WP_003408180.1.74809 WP_003408180.1.74820 WP_003408180.1.74870 WP_003408180.1.74881 WP_003408180.1.74888 WP_003408180.1.74952 WP_003408180.1.7496 WP_003408180.1.74988 WP_003408180.1.75043 WP_003408180.1.75045 WP_003408180.1.75078 WP_003408180.1.75081 WP_003408180.1.75120 WP_003408180.1.75163 WP_003408180.1.75188 WP_003408180.1.75202 WP_003408180.1.75234 WP_003408180.1.75239 WP_003408180.1.75263 WP_003408180.1.75342 WP_003408180.1.7535 WP_003408180.1.75376 WP_003408180.1.75391 WP_003408180.1.75395 WP_003408180.1.75441 WP_003408180.1.75510 WP_003408180.1.75581 WP_003408180.1.75598 WP_003408180.1.75635 WP_003408180.1.75665 WP_003408180.1.75671 WP_003408180.1.75741 WP_003408180.1.75749 WP_003408180.1.75772 WP_003408180.1.75774 WP_003408180.1.75833 WP_003408180.1.7585 WP_003408180.1.75864 WP_003408180.1.75878 WP_003408180.1.75927 WP_003408180.1.75946 WP_003408180.1.75968 WP_003408180.1.75974 WP_003408180.1.76016 WP_003408180.1.76032 WP_003408180.1.76037 WP_003408180.1.7604 WP_003408180.1.76045 WP_003408180.1.76052 WP_003408180.1.76058 WP_003408180.1.76126 WP_003408180.1.76138 WP_003408180.1.76157 WP_003408180.1.76172 WP_003408180.1.76177 WP_003408180.1.76183 WP_003408180.1.76209 WP_003408180.1.76239 WP_003408180.1.76277 WP_003408180.1.76281 WP_003408180.1.76297 WP_003408180.1.76360 WP_003408180.1.76379 WP_003408180.1.76403 WP_003408180.1.76413 WP_003408180.1.76414 WP_003408180.1.76427 WP_003408180.1.76436 WP_003408180.1.76442 WP_003408180.1.76443 WP_003408180.1.76456 WP_003408180.1.76533 WP_003408180.1.76616 WP_003408180.1.76625 WP_003408180.1.76629 WP_003408180.1.76635 WP_003408180.1.76638 WP_003408180.1.76640 WP_003408180.1.76644 WP_003408180.1.76677 WP_003408180.1.76678 WP_003408180.1.76734 WP_003408180.1.76744 WP_003408180.1.76750 WP_003408180.1.76754 WP_003408180.1.76757 WP_003408180.1.76781 WP_003408180.1.76818 WP_003408180.1.76824 WP_003408180.1.76835 WP_003408180.1.76873 WP_003408180.1.76888 WP_003408180.1.76900 WP_003408180.1.7691 WP_003408180.1.76947 WP_003408180.1.76954 WP_003408180.1.76955 WP_003408180.1.76963 WP_003408180.1.76976 WP_003408180.1.770 WP_003408180.1.77000 WP_003408180.1.77008 WP_003408180.1.77021 WP_003408180.1.77056 WP_003408180.1.77065 WP_003408180.1.77075 WP_003408180.1.77093 WP_003408180.1.77115 WP_003408180.1.77118 WP_003408180.1.77125 WP_003408180.1.77141 WP_003408180.1.77142 WP_003408180.1.77166 WP_003408180.1.77250 WP_003408180.1.77260 WP_003408180.1.77266 WP_003408180.1.77285 WP_003408180.1.77312 WP_003408180.1.77348 WP_003408180.1.77351 WP_003408180.1.77352 WP_003408180.1.77361 WP_003408180.1.77404 WP_003408180.1.77425 WP_003408180.1.77463 WP_003408180.1.77474 WP_003408180.1.7748 WP_003408180.1.77491 WP_003408180.1.77499 WP_003408180.1.77510 WP_003408180.1.77530 WP_003408180.1.77554 WP_003408180.1.77559 WP_003408180.1.77599 WP_003408180.1.7762 WP_003408180.1.77627 WP_003408180.1.77649 WP_003408180.1.7766 WP_003408180.1.77667 WP_003408180.1.77706 WP_003408180.1.77774 WP_003408180.1.77790 WP_003408180.1.77809 WP_003408180.1.77820 WP_003408180.1.77843 WP_003408180.1.77855 WP_003408180.1.77865 WP_003408180.1.77868 WP_003408180.1.77879 WP_003408180.1.77890 WP_003408180.1.77909 WP_003408180.1.77911 WP_003408180.1.77931 WP_003408180.1.77984 WP_003408180.1.78020 WP_003408180.1.78024 WP_003408180.1.78075 WP_003408180.1.78086 WP_003408180.1.7809 WP_003408180.1.78098 WP_003408180.1.78105 WP_003408180.1.78113 WP_003408180.1.78136 WP_003408180.1.78162 WP_003408180.1.7817 WP_003408180.1.78200 WP_003408180.1.78216 WP_003408180.1.78236 WP_003408180.1.78238 WP_003408180.1.78322 WP_003408180.1.78338 WP_003408180.1.7836 WP_003408180.1.78360 WP_003408180.1.78386 WP_003408180.1.78429 WP_003408180.1.78435 WP_003408180.1.7844 WP_003408180.1.78459 WP_003408180.1.78488 WP_003408180.1.78499 WP_003408180.1.785 WP_003408180.1.78516 WP_003408180.1.78524 WP_003408180.1.78526 WP_003408180.1.78538 WP_003408180.1.78544 WP_003408180.1.78545 WP_003408180.1.78547 WP_003408180.1.78574 WP_003408180.1.78580 WP_003408180.1.78620 WP_003408180.1.78646 WP_003408180.1.78649 WP_003408180.1.78655 WP_003408180.1.78657 WP_003408180.1.78659 WP_003408180.1.7869 WP_003408180.1.78692 WP_003408180.1.78760 WP_003408180.1.78766 WP_003408180.1.78776 WP_003408180.1.78778 WP_003408180.1.78784 WP_003408180.1.78788 WP_003408180.1.78790 WP_003408180.1.78848 WP_003408180.1.78860 WP_003408180.1.7887 WP_003408180.1.78884 WP_003408180.1.78932 WP_003408180.1.78969 WP_003408180.1.78977 WP_003408180.1.78980 WP_003408180.1.79005 WP_003408180.1.79016 WP_003408180.1.79033 WP_003408180.1.79066 WP_003408180.1.79068 WP_003408180.1.79095 WP_003408180.1.79122 WP_003408180.1.79145 WP_003408180.1.79152 WP_003408180.1.79163 WP_003408180.1.79182 WP_003408180.1.79213 WP_003408180.1.79218 WP_003408180.1.79268 WP_003408180.1.79278 WP_003408180.1.79290 WP_003408180.1.79319 WP_003408180.1.79326 WP_003408180.1.7933 WP_003408180.1.79330 WP_003408180.1.79339 WP_003408180.1.79394 WP_003408180.1.79399 WP_003408180.1.79413 WP_003408180.1.79422 WP_003408180.1.79445 WP_003408180.1.79447 WP_003408180.1.79455 WP_003408180.1.79471 WP_003408180.1.79480 WP_003408180.1.79482 WP_003408180.1.79488 WP_003408180.1.79500 WP_003408180.1.79502 WP_003408180.1.79508 WP_003408180.1.79514 WP_003408180.1.79561 WP_003408180.1.79565 WP_003408180.1.79578 WP_003408180.1.79588 WP_003408180.1.79598 WP_003408180.1.79615 WP_003408180.1.79684 WP_003408180.1.79744 WP_003408180.1.79784 WP_003408180.1.79806 WP_003408180.1.79819 WP_003408180.1.79826 WP_003408180.1.79851 WP_003408180.1.79853 WP_003408180.1.79863 WP_003408180.1.79881 WP_003408180.1.79885 WP_003408180.1.79898 WP_003408180.1.7990 WP_003408180.1.79900 WP_003408180.1.79913 WP_003408180.1.79918 WP_003408180.1.79947 WP_003408180.1.79948 WP_003408180.1.7995 WP_003408180.1.7997 WP_003408180.1.80004 WP_003408180.1.80022 WP_003408180.1.80030 WP_003408180.1.80054 WP_003408180.1.80084 WP_003408180.1.80099 WP_003408180.1.80129 WP_003408180.1.80177 WP_003408180.1.80234 WP_003408180.1.8026 WP_003408180.1.80275 WP_003408180.1.8029 WP_003408180.1.80299 WP_003408180.1.80304 WP_003408180.1.80326 WP_003408180.1.8037 WP_003408180.1.80370 WP_003408180.1.80387 WP_003408180.1.8044 WP_003408180.1.80451 WP_003408180.1.80458 WP_003408180.1.80490 WP_003408180.1.80503 WP_003408180.1.80507 WP_003408180.1.80552 WP_003408180.1.80576 WP_003408180.1.80588 WP_003408180.1.80599 WP_003408180.1.80624 WP_003408180.1.80636 WP_003408180.1.80673 WP_003408180.1.80711 WP_003408180.1.80714 WP_003408180.1.80743 WP_003408180.1.80784 WP_003408180.1.80815 WP_003408180.1.80853 WP_003408180.1.8093 WP_003408180.1.8097 WP_003408180.1.81007 WP_003408180.1.81013 WP_003408180.1.8105 WP_003408180.1.81059 WP_003408180.1.81075 WP_003408180.1.81091 WP_003408180.1.81119 WP_003408180.1.81125 WP_003408180.1.81136 WP_003408180.1.8114 WP_003408180.1.81189 WP_003408180.1.81192 WP_003408180.1.812 WP_003408180.1.81230 WP_003408180.1.81249 WP_003408180.1.81250 WP_003408180.1.81264 WP_003408180.1.81297 WP_003408180.1.8138 WP_003408180.1.81407 WP_003408180.1.8143 WP_003408180.1.81439 WP_003408180.1.81465 WP_003408180.1.81529 WP_003408180.1.81538 WP_003408180.1.81541 WP_003408180.1.81560 WP_003408180.1.81561 WP_003408180.1.81567 WP_003408180.1.81583 WP_003408180.1.81686 WP_003408180.1.81712 WP_003408180.1.81720 WP_003408180.1.81774 WP_003408180.1.81820 WP_003408180.1.81850 WP_003408180.1.81883 WP_003408180.1.81891 WP_003408180.1.81918 WP_003408180.1.82048 WP_003408180.1.82069 WP_003408180.1.82071 WP_003408180.1.82108 WP_003408180.1.82136 WP_003408180.1.82142 WP_003408180.1.8215 WP_003408180.1.82158 WP_003408180.1.82209 WP_003408180.1.82210 WP_003408180.1.82228 WP_003408180.1.82236 WP_003408180.1.82251 WP_003408180.1.82271 WP_003408180.1.82305 WP_003408180.1.82307 WP_003408180.1.82309 WP_003408180.1.82317 WP_003408180.1.8232 WP_003408180.1.82346 WP_003408180.1.82374 WP_003408180.1.82385 WP_003408180.1.82429 WP_003408180.1.82460 WP_003408180.1.82483 WP_003408180.1.82494 WP_003408180.1.82531 WP_003408180.1.82546 WP_003408180.1.82547 WP_003408180.1.82549 WP_003408180.1.82577 WP_003408180.1.82592 WP_003408180.1.82597 WP_003408180.1.82598 WP_003408180.1.82625 WP_003408180.1.82642 WP_003408180.1.82651 WP_003408180.1.82653 WP_003408180.1.82681 WP_003408180.1.82685 WP_003408180.1.8271 WP_003408180.1.82712 WP_003408180.1.8273 WP_003408180.1.82743 WP_003408180.1.82757 WP_003408180.1.82774 WP_003408180.1.82803 WP_003408180.1.82836 WP_003408180.1.82860 WP_003408180.1.82871 WP_003408180.1.82892 WP_003408180.1.82935 WP_003408180.1.82957 WP_003408180.1.82981 WP_003408180.1.82983 WP_003408180.1.83004 WP_003408180.1.83009 WP_003408180.1.83044 WP_003408180.1.83065 WP_003408180.1.83074 WP_003408180.1.83146 WP_003408180.1.83149 WP_003408180.1.83159 WP_003408180.1.8317 WP_003408180.1.83181 WP_003408180.1.83182 WP_003408180.1.83191 WP_003408180.1.83197 WP_003408180.1.83212 WP_003408180.1.8326 WP_003408180.1.83262 WP_003408180.1.83268 WP_003408180.1.83309 WP_003408180.1.83332 WP_003408180.1.83334 WP_003408180.1.83341 WP_003408180.1.83349 WP_003408180.1.8335 WP_003408180.1.83353 WP_003408180.1.83367 WP_003408180.1.83380 WP_003408180.1.83381 WP_003408180.1.83389 WP_003408180.1.83408 WP_003408180.1.83409 WP_003408180.1.83435 WP_003408180.1.83470 WP_003408180.1.83524 WP_003408180.1.83526 WP_003408180.1.8358 WP_003408180.1.83589 WP_003408180.1.83601 WP_003408180.1.83611 WP_003408180.1.83638 WP_003408180.1.83656 WP_003408180.1.83667 WP_003408180.1.83689 WP_003408180.1.83692 WP_003408180.1.83704 WP_003408180.1.83705 WP_003408180.1.83766 WP_003408180.1.83793 WP_003408180.1.83794 WP_003408180.1.83802 WP_003408180.1.83805 WP_003408180.1.83839 WP_003408180.1.83842 WP_003408180.1.83850 WP_003408180.1.83861 WP_003408180.1.83884 WP_003408180.1.83920 WP_003408180.1.83929 WP_003408180.1.83930 WP_003408180.1.83975 WP_003408180.1.83991 WP_003408180.1.8400 WP_003408180.1.84027 WP_003408180.1.8404 WP_003408180.1.84057 WP_003408180.1.84070 WP_003408180.1.84112 WP_003408180.1.84146 WP_003408180.1.8415 WP_003408180.1.84176 WP_003408180.1.84192 WP_003408180.1.84228 WP_003408180.1.8424 WP_003408180.1.84244 WP_003408180.1.84259 WP_003408180.1.8426 WP_003408180.1.84277 WP_003408180.1.84287 WP_003408180.1.8434 WP_003408180.1.84388 WP_003408180.1.84409 WP_003408180.1.84438 WP_003408180.1.84460 WP_003408180.1.84488 WP_003408180.1.84504 WP_003408180.1.84525 WP_003408180.1.84620 WP_003408180.1.84623 WP_003408180.1.84641 WP_003408180.1.84655 WP_003408180.1.84666 WP_003408180.1.84670 WP_003408180.1.84739 WP_003408180.1.84748 WP_003408180.1.84766 WP_003408180.1.84772 WP_003408180.1.84774 WP_003408180.1.848 WP_003408180.1.84812 WP_003408180.1.84836 WP_003408180.1.84873 WP_003408180.1.84911 WP_003408180.1.84938 WP_003408180.1.84968 WP_003408180.1.84981 WP_003408180.1.84985 WP_003408180.1.8503 WP_003408180.1.85038 WP_003408180.1.85043 WP_003408180.1.8505 WP_003408180.1.8509 WP_003408180.1.8512 WP_003408180.1.8518 WP_003408180.1.8522 WP_003408180.1.85242 WP_003408180.1.85276 WP_003408180.1.85281 WP_003408180.1.85284 WP_003408180.1.85314 WP_003408180.1.85319 WP_003408180.1.85330 WP_003408180.1.85341 WP_003408180.1.8535 WP_003408180.1.85363 WP_003408180.1.85371 WP_003408180.1.85387 WP_003408180.1.85399 WP_003408180.1.85458 WP_003408180.1.8546 WP_003408180.1.85478 WP_003408180.1.85480 WP_003408180.1.85488 WP_003408180.1.85495 WP_003408180.1.85551 WP_003408180.1.85557 WP_003408180.1.85577 WP_003408180.1.85599 WP_003408180.1.85610 WP_003408180.1.8563 WP_003408180.1.85648 WP_003408180.1.85679 WP_003408180.1.85704 WP_003408180.1.85717 WP_003408180.1.85727 WP_003408180.1.85737 WP_003408180.1.85763 WP_003408180.1.85808 WP_003408180.1.85819 WP_003408180.1.85820 WP_003408180.1.85823 WP_003408180.1.85832 WP_003408180.1.8586 WP_003408180.1.85872 WP_003408180.1.85894 WP_003408180.1.85909 WP_003408180.1.85913 WP_003408180.1.85953 WP_003408180.1.85986 WP_003408180.1.86000 WP_003408180.1.86025 WP_003408180.1.86032 WP_003408180.1.86048 WP_003408180.1.86052 WP_003408180.1.86067 WP_003408180.1.86103 WP_003408180.1.86122 WP_003408180.1.86124 WP_003408180.1.86160 WP_003408180.1.86164 WP_003408180.1.86190 WP_003408180.1.86204 WP_003408180.1.86208 WP_003408180.1.86235 WP_003408180.1.86249 WP_003408180.1.86260 WP_003408180.1.86290 WP_003408180.1.863 WP_003408180.1.86327 WP_003408180.1.86334 WP_003408180.1.86337 WP_003408180.1.86368 WP_003408180.1.86377 WP_003408180.1.86425 WP_003408180.1.86459 WP_003408180.1.8649 WP_003408180.1.86499 WP_003408180.1.86520 WP_003408180.1.86561 WP_003408180.1.86568 WP_003408180.1.86575 WP_003408180.1.86584 WP_003408180.1.86605 WP_003408180.1.86626 WP_003408180.1.86648 WP_003408180.1.86684 WP_003408180.1.86696 WP_003408180.1.86705 WP_003408180.1.86718 WP_003408180.1.86725 WP_003408180.1.86757 WP_003408180.1.86766 WP_003408180.1.86801 WP_003408180.1.86814 WP_003408180.1.86820 WP_003408180.1.86825 WP_003408180.1.86834 WP_003408180.1.8685 WP_003408180.1.86851 WP_003408180.1.86855 WP_003408180.1.86867 WP_003408180.1.86877 WP_003408180.1.8689 WP_003408180.1.86892 WP_003408180.1.86933 WP_003408180.1.86941 WP_003408180.1.86950 WP_003408180.1.86962 WP_003408180.1.86963 WP_003408180.1.86979 WP_003408180.1.8700 WP_003408180.1.87002 WP_003408180.1.87031 WP_003408180.1.87116 WP_003408180.1.87117 WP_003408180.1.8714 WP_003408180.1.87162 WP_003408180.1.87178 WP_003408180.1.87191 WP_003408180.1.87201 WP_003408180.1.87209 WP_003408180.1.87240 WP_003408180.1.87266 WP_003408180.1.87273 WP_003408180.1.87275 WP_003408180.1.8733 WP_003408180.1.87345 WP_003408180.1.8737 WP_003408180.1.87401 WP_003408180.1.87409 WP_003408180.1.87444 WP_003408180.1.87446 WP_003408180.1.87459 WP_003408180.1.87472 WP_003408180.1.87489 WP_003408180.1.87494 WP_003408180.1.87496 WP_003408180.1.87582 WP_003408180.1.87588 WP_003408180.1.87619 WP_003408180.1.87620 WP_003408180.1.87634 WP_003408180.1.87643 WP_003408180.1.87650 WP_003408180.1.87654 WP_003408180.1.87658 WP_003408180.1.87665 WP_003408180.1.87676 WP_003408180.1.87677 WP_003408180.1.87684 WP_003408180.1.87692 WP_003408180.1.87707 WP_003408180.1.87732 WP_003408180.1.87784 WP_003408180.1.87796 WP_003408180.1.87809 WP_003408180.1.87817 WP_003408180.1.87827 WP_003408180.1.87831 WP_003408180.1.87835 WP_003408180.1.87837 WP_003408180.1.87866 WP_003408180.1.8789 WP_003408180.1.87911 WP_003408180.1.87924 WP_003408180.1.87951 WP_003408180.1.87956 WP_003408180.1.87991 WP_003408180.1.88 WP_003408180.1.88037 WP_003408180.1.88039 WP_003408180.1.88072 WP_003408180.1.88077 WP_003408180.1.88121 WP_003408180.1.88191 WP_003408180.1.88205 WP_003408180.1.88217 WP_003408180.1.88219 WP_003408180.1.88253 WP_003408180.1.88294 WP_003408180.1.88315 WP_003408180.1.88316 WP_003408180.1.88320 WP_003408180.1.88338 WP_003408180.1.8840 WP_003408180.1.88437 WP_003408180.1.88453 WP_003408180.1.88489 WP_003408180.1.88507 WP_003408180.1.88530 WP_003408180.1.88537 WP_003408180.1.88541 WP_003408180.1.88592 WP_003408180.1.88616 WP_003408180.1.88618 WP_003408180.1.8862 WP_003408180.1.88625 WP_003408180.1.88632 WP_003408180.1.88634 WP_003408180.1.88649 WP_003408180.1.8870 WP_003408180.1.88737 WP_003408180.1.888 WP_003408180.1.88824 WP_003408180.1.88886 WP_003408180.1.88965 WP_003408180.1.88985 WP_003408180.1.8902 WP_003408180.1.89025 WP_003408180.1.89041 WP_003408180.1.89046 WP_003408180.1.89082 WP_003408180.1.89162 WP_003408180.1.89168 WP_003408180.1.8917 WP_003408180.1.89205 WP_003408180.1.89207 WP_003408180.1.89225 WP_003408180.1.8925 WP_003408180.1.89277 WP_003408180.1.89286 WP_003408180.1.89293 WP_003408180.1.89320 WP_003408180.1.8935 WP_003408180.1.89378 WP_003408180.1.89392 WP_003408180.1.89406 WP_003408180.1.8943 WP_003408180.1.89451 WP_003408180.1.89453 WP_003408180.1.89473 WP_003408180.1.89475 WP_003408180.1.89483 WP_003408180.1.895 WP_003408180.1.89513 WP_003408180.1.89517 WP_003408180.1.89522 WP_003408180.1.8954 WP_003408180.1.89543 WP_003408180.1.8957 WP_003408180.1.89572 WP_003408180.1.89607 WP_003408180.1.89613 WP_003408180.1.89625 WP_003408180.1.89648 WP_003408180.1.8967 WP_003408180.1.89670 WP_003408180.1.89676 WP_003408180.1.89729 WP_003408180.1.89739 WP_003408180.1.89762 WP_003408180.1.8977 WP_003408180.1.89802 WP_003408180.1.89808 WP_003408180.1.8982 WP_003408180.1.89829 WP_003408180.1.89831 WP_003408180.1.89844 WP_003408180.1.89849 WP_003408180.1.8989 WP_003408180.1.89903 WP_003408180.1.89922 WP_003408180.1.89926 WP_003408180.1.89971 WP_003408180.1.8998 WP_003408180.1.89987 WP_003408180.1.900 WP_003408180.1.90048 WP_003408180.1.9007 WP_003408180.1.90080 WP_003408180.1.90130 WP_003408180.1.90137 WP_003408180.1.90157 WP_003408180.1.90184 WP_003408180.1.90199 WP_003408180.1.90231 WP_003408180.1.90245 WP_003408180.1.90308 WP_003408180.1.90322 WP_003408180.1.90328 WP_003408180.1.90372 WP_003408180.1.90481 WP_003408180.1.90499 WP_003408180.1.9050 WP_003408180.1.90527 WP_003408180.1.90550 WP_003408180.1.90560 WP_003408180.1.90612 WP_003408180.1.90640 WP_003408180.1.90672 WP_003408180.1.90687 WP_003408180.1.90691 WP_003408180.1.90711 WP_003408180.1.90722 WP_003408180.1.90744 WP_003408180.1.9075 WP_003408180.1.90767 WP_003408180.1.90771 WP_003408180.1.90788 WP_003408180.1.90800 WP_003408180.1.90810 WP_003408180.1.90816 WP_003408180.1.90819 WP_003408180.1.9082 WP_003408180.1.90831 WP_003408180.1.90899 WP_003408180.1.90906 WP_003408180.1.90958 WP_003408180.1.90976 WP_003408180.1.90977 WP_003408180.1.90987 WP_003408180.1.9102 WP_003408180.1.91026 WP_003408180.1.91032 WP_003408180.1.91053 WP_003408180.1.91082 WP_003408180.1.91112 WP_003408180.1.91144 WP_003408180.1.91151 WP_003408180.1.91157 WP_003408180.1.91167 WP_003408180.1.91192 WP_003408180.1.91201 WP_003408180.1.91207 WP_003408180.1.91208 WP_003408180.1.91214 WP_003408180.1.91230 WP_003408180.1.91244 WP_003408180.1.91251 WP_003408180.1.91260 WP_003408180.1.9128 WP_003408180.1.91284 WP_003408180.1.91294 WP_003408180.1.91303 WP_003408180.1.91322 WP_003408180.1.91386 WP_003408180.1.9139 WP_003408180.1.91398 WP_003408180.1.91411 WP_003408180.1.91430 WP_003408180.1.91436 WP_003408180.1.91483 WP_003408180.1.91496 WP_003408180.1.91507 WP_003408180.1.91508 WP_003408180.1.91576 WP_003408180.1.91589 WP_003408180.1.91694 WP_003408180.1.91695 WP_003408180.1.91717 WP_003408180.1.91728 WP_003408180.1.91743 WP_003408180.1.91759 WP_003408180.1.91784 WP_003408180.1.91785 WP_003408180.1.91786 WP_003408180.1.91802 WP_003408180.1.91822 WP_003408180.1.9189 WP_003408180.1.91896 WP_003408180.1.9190 WP_003408180.1.91915 WP_003408180.1.91931 WP_003408180.1.91937 WP_003408180.1.91944 WP_003408180.1.91957 WP_003408180.1.91976 WP_003408180.1.92083 WP_003408180.1.92127 WP_003408180.1.92144 WP_003408180.1.92150 WP_003408180.1.92153 WP_003408180.1.92190 WP_003408180.1.92192 WP_003408180.1.92200 WP_003408180.1.92220 WP_003408180.1.92221 WP_003408180.1.92222 WP_003408180.1.92289 WP_003408180.1.92294 WP_003408180.1.92300 WP_003408180.1.92317 WP_003408180.1.92334 WP_003408180.1.92338 WP_003408180.1.92345 WP_003408180.1.92356 WP_003408180.1.92364 WP_003408180.1.92380 WP_003408180.1.92416 WP_003408180.1.92447 WP_003408180.1.92456 WP_003408180.1.92467 WP_003408180.1.92471 WP_003408180.1.92490 WP_003408180.1.92508 WP_003408180.1.9251 WP_003408180.1.92511 WP_003408180.1.92523 WP_003408180.1.92527 WP_003408180.1.92536 WP_003408180.1.92592 WP_003408180.1.92597 WP_003408180.1.92603 WP_003408180.1.92606 WP_003408180.1.92610 WP_003408180.1.92613 WP_003408180.1.9263 WP_003408180.1.9265 WP_003408180.1.92650 WP_003408180.1.92660 WP_003408180.1.92677 WP_003408180.1.92685 WP_003408180.1.92689 WP_003408180.1.92690 WP_003408180.1.92706 WP_003408180.1.92714 WP_003408180.1.92736 WP_003408180.1.9274 WP_003408180.1.92752 WP_003408180.1.92760 WP_003408180.1.92803 WP_003408180.1.92833 WP_003408180.1.92856 WP_003408180.1.92881 WP_003408180.1.92892 WP_003408180.1.92907 WP_003408180.1.92908 WP_003408180.1.9291 WP_003408180.1.92917 WP_003408180.1.92996 WP_003408180.1.93006 WP_003408180.1.93008 WP_003408180.1.93009 WP_003408180.1.93015 WP_003408180.1.93043 WP_003408180.1.9307 WP_003408180.1.93097 WP_003408180.1.93137 WP_003408180.1.93192 WP_003408180.1.93203 WP_003408180.1.93212 WP_003408180.1.93234 WP_003408180.1.93245 WP_003408180.1.93257 WP_003408180.1.93265 WP_003408180.1.93320 WP_003408180.1.93328 WP_003408180.1.93337 WP_003408180.1.93343 WP_003408180.1.93349 WP_003408180.1.93377 WP_003408180.1.9338 WP_003408180.1.93407 WP_003408180.1.93417 WP_003408180.1.93419 WP_003408180.1.93426 WP_003408180.1.9344 WP_003408180.1.93443 WP_003408180.1.93470 WP_003408180.1.93483 WP_003408180.1.93487 WP_003408180.1.93495 WP_003408180.1.93499 WP_003408180.1.93516 WP_003408180.1.93544 WP_003408180.1.93555 WP_003408180.1.93560 WP_003408180.1.93564 WP_003408180.1.93573 WP_003408180.1.93576 WP_003408180.1.93588 WP_003408180.1.9363 WP_003408180.1.93645 WP_003408180.1.93649 WP_003408180.1.93659 WP_003408180.1.93677 WP_003408180.1.9368 WP_003408180.1.93689 WP_003408180.1.93693 WP_003408180.1.93706 WP_003408180.1.9371 WP_003408180.1.93792 WP_003408180.1.93823 WP_003408180.1.93871 WP_003408180.1.9388 WP_003408180.1.93894 WP_003408180.1.93903 WP_003408180.1.93907 WP_003408180.1.93913 WP_003408180.1.93950 WP_003408180.1.93953 WP_003408180.1.93954 WP_003408180.1.93988 WP_003408180.1.9407 WP_003408180.1.94143 WP_003408180.1.94154 WP_003408180.1.94184 WP_003408180.1.94204 WP_003408180.1.94205 WP_003408180.1.94226 WP_003408180.1.94231 WP_003408180.1.94256 WP_003408180.1.94261 WP_003408180.1.94281 WP_003408180.1.94292 WP_003408180.1.94297 WP_003408180.1.9431 WP_003408180.1.94326 WP_003408180.1.94339 WP_003408180.1.94392 WP_003408180.1.94416 WP_003408180.1.94421 WP_003408180.1.94456 WP_003408180.1.94470 WP_003408180.1.94480 WP_003408180.1.94495 WP_003408180.1.94511 WP_003408180.1.94512 WP_003408180.1.94525 WP_003408180.1.94528 WP_003408180.1.94564 WP_003408180.1.946 WP_003408180.1.94623 WP_003408180.1.94629 WP_003408180.1.9465 WP_003408180.1.94673 WP_003408180.1.94714 WP_003408180.1.94730 WP_003408180.1.94736 WP_003408180.1.94776 WP_003408180.1.9478 WP_003408180.1.94834 WP_003408180.1.94852 WP_003408180.1.94872 WP_003408180.1.9488 WP_003408180.1.94902 WP_003408180.1.94916 WP_003408180.1.94979 WP_003408180.1.94994 WP_003408180.1.94996 WP_003408180.1.94998 WP_003408180.1.95007 WP_003408180.1.95010 WP_003408180.1.95015 WP_003408180.1.95034 WP_003408180.1.95068 WP_003408180.1.95081 WP_003408180.1.95082 WP_003408180.1.9509 WP_003408180.1.95096 WP_003408180.1.95112 WP_003408180.1.95138 WP_003408180.1.9514 WP_003408180.1.95179 WP_003408180.1.95190 WP_003408180.1.95234 WP_003408180.1.95241 WP_003408180.1.95245 WP_003408180.1.95257 WP_003408180.1.95279 WP_003408180.1.9531 WP_003408180.1.95335 WP_003408180.1.95344 WP_003408180.1.9535 WP_003408180.1.95370 WP_003408180.1.95392 WP_003408180.1.95416 WP_003408180.1.95417 WP_003408180.1.95454 WP_003408180.1.95455 WP_003408180.1.95497 WP_003408180.1.95508 WP_003408180.1.95509 WP_003408180.1.95529 WP_003408180.1.95556 WP_003408180.1.95557 WP_003408180.1.95565 WP_003408180.1.95578 WP_003408180.1.95580 WP_003408180.1.95585 WP_003408180.1.95643 WP_003408180.1.95685 WP_003408180.1.957 WP_003408180.1.95727 WP_003408180.1.95730 WP_003408180.1.95735 WP_003408180.1.95758 WP_003408180.1.95772 WP_003408180.1.95797 WP_003408180.1.95839 WP_003408180.1.9585 WP_003408180.1.9590 WP_003408180.1.95902 WP_003408180.1.95908 WP_003408180.1.95924 WP_003408180.1.95926 WP_003408180.1.95953 WP_003408180.1.95958 WP_003408180.1.95964 WP_003408180.1.95973 WP_003408180.1.96006 WP_003408180.1.9602 WP_003408180.1.96062 WP_003408180.1.96098 WP_003408180.1.96146 WP_003408180.1.96171 WP_003408180.1.96182 WP_003408180.1.96204 WP_003408180.1.96230 WP_003408180.1.96242 WP_003408180.1.96245 WP_003408180.1.96254 WP_003408180.1.96259 WP_003408180.1.96286 WP_003408180.1.96313 WP_003408180.1.96345 WP_003408180.1.96360 WP_003408180.1.96373 WP_003408180.1.96456 WP_003408180.1.96486 WP_003408180.1.96569 WP_003408180.1.96573 WP_003408180.1.96576 WP_003408180.1.96611 WP_003408180.1.96621 WP_003408180.1.9667 WP_003408180.1.96681 WP_003408180.1.96726 WP_003408180.1.96733 WP_003408180.1.96742 WP_003408180.1.96754 WP_003408180.1.9678 WP_003408180.1.96832 WP_003408180.1.9685 WP_003408180.1.97008 WP_003408180.1.97009 WP_003408180.1.97056 WP_003408180.1.97084 WP_003408180.1.97087 WP_003408180.1.97094 WP_003408180.1.97096 WP_003408180.1.97099 WP_003408180.1.97108 WP_003408180.1.97113 WP_003408180.1.97122 WP_003408180.1.97129 WP_003408180.1.97136 WP_003408180.1.9716 WP_003408180.1.97176 WP_003408180.1.97222 WP_003408180.1.97237 WP_003408180.1.97242 WP_003408180.1.97283 WP_003408180.1.97296 WP_003408180.1.97321 WP_003408180.1.97325 WP_003408180.1.97330 WP_003408180.1.97366 WP_003408180.1.97376 WP_003408180.1.97380 WP_003408180.1.97462 WP_003408180.1.97517 WP_003408180.1.97535 WP_003408180.1.97540 WP_003408180.1.97545 WP_003408180.1.97546 WP_003408180.1.97550 WP_003408180.1.97577 WP_003408180.1.97584 WP_003408180.1.9759 WP_003408180.1.97591 WP_003408180.1.97596 WP_003408180.1.97609 WP_003408180.1.97618 WP_003408180.1.9763 WP_003408180.1.97669 WP_003408180.1.97701 WP_003408180.1.9773 WP_003408180.1.97730 WP_003408180.1.97740 WP_003408180.1.97751 WP_003408180.1.97754 WP_003408180.1.97797 WP_003408180.1.9782 WP_003408180.1.97888 WP_003408180.1.9790 WP_003408180.1.97951 WP_003408180.1.97958 WP_003408180.1.97966 WP_003408180.1.97977 WP_003408180.1.97979 WP_003408180.1.97995 WP_003408180.1.98034 WP_003408180.1.98052 WP_003408180.1.98071 WP_003408180.1.98072 WP_003408180.1.98113 WP_003408180.1.98114 WP_003408180.1.98128 WP_003408180.1.98188 WP_003408180.1.98189 WP_003408180.1.98213 WP_003408180.1.98225 WP_003408180.1.98291 WP_003408180.1.98350 WP_003408180.1.98395 WP_003408180.1.98412 WP_003408180.1.98441 WP_003408180.1.98443 WP_003408180.1.98462 WP_003408180.1.9848 WP_003408180.1.98482 WP_003408180.1.98503 WP_003408180.1.98516 WP_003408180.1.98536 WP_003408180.1.98541 WP_003408180.1.98566 WP_003408180.1.98576 WP_003408180.1.98594 WP_003408180.1.98599 WP_003408180.1.98629 WP_003408180.1.98645 WP_003408180.1.98646 WP_003408180.1.98649 WP_003408180.1.9867 WP_003408180.1.98697 WP_003408180.1.98739 WP_003408180.1.98749 WP_003408180.1.98765 WP_003408180.1.98770 WP_003408180.1.98777 WP_003408180.1.98778 WP_003408180.1.98802 WP_003408180.1.98838 WP_003408180.1.98906 WP_003408180.1.98935 WP_003408180.1.98948 WP_003408180.1.98953 WP_003408180.1.98984 WP_003408180.1.99000 WP_003408180.1.99023 WP_003408180.1.99030 WP_003408180.1.99037 WP_003408180.1.99062 WP_003408180.1.99086 WP_003408180.1.99115 WP_003408180.1.99176 WP_003408180.1.99211 WP_003408180.1.99216 WP_003408180.1.99222 WP_003408180.1.99251 WP_003408180.1.99269 WP_003408180.1.99294 WP_003408180.1.99312 WP_003408180.1.99315 WP_003408180.1.99322 WP_003408180.1.99328 WP_003408180.1.99365 WP_003408180.1.99368 WP_003408180.1.99379 WP_003408180.1.99396 WP_003408180.1.99402 WP_003408180.1.99419 WP_003408180.1.99438 WP_003408180.1.99460 WP_003408180.1.99468 WP_003408180.1.99473 WP_003408180.1.99513 WP_003408180.1.99529 WP_003408180.1.99548 WP_003408180.1.99572 WP_003408180.1.99575 WP_003408180.1.99578 WP_003408180.1.99605 WP_003408180.1.99609 WP_003408180.1.99617 WP_003408180.1.99635 WP_003408180.1.99650 WP_003408180.1.99672 WP_003408180.1.99701 WP_003408180.1.99711 WP_003408180.1.99716 WP_003408180.1.99745 WP_003408180.1.99749 WP_003408180.1.9976 WP_003408180.1.99798 WP_003408180.1.99817 WP_003408180.1.99847 WP_003408180.1.99852 WP_003408180.1.99886 WP_003408180.1.99897 WP_003408180.1.99899 WP_003408180.1.99915 WP_003408180.1.99991 gi|392432758|ref|YP_006473802.1| gi|15608797|ref|NP_216175.1| gi|449063719|ref|YP_007430802.1| gi|224990042|ref|YP_002644729.1| gi|148661455|ref|YP_001282978.1| gi|15608797|ref|NP_216175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]