SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15609874|ref|NP_217253.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15609874|ref|NP_217253.1|
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.1e-65
Family RecA protein-like (ATPase-domain) 0.000000000911
Further Details:      
 
Domain Number 2 Region: 251-374,627-691
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.75e-36
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 3 Region: 710-768
Classification Level Classification E-value
Superfamily RecA protein, C-terminal domain 6.93e-20
Family RecA protein, C-terminal domain 0.0000319
Further Details:      
 
Domain Number 4 Region: 458-563
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000272
Family Group I mobile intron endonuclease 0.067
Further Details:      
 
Weak hits

Sequence:  gi|15609874|ref|NP_217253.1|
Domain Number - Region: 575-610
Classification Level Classification E-value
Superfamily Mitochondrial glycoprotein MAM33-like 0.00706
Family Mitochondrial glycoprotein MAM33-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15609874|ref|NP_217253.1|
Sequence length 790
Comment RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)] [Mycobacterium tuberculosis H37Rv]
Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRG
RVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQP
DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMT
GALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVG
NRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIP
ADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTRIAATLGCAAHPQGRISLAIA
HRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQ
TGALRVGYTTTSEQLAHQIHWLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVR
ISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVI
REVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAEFDILYGKGISREGSLIDMGV
DQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSN
DGVLPAPVDF
Download sequence
Identical sequences A0A045GV14 A0A083VZZ9 A0A0H3LJJ4 A0A0H3MG83 A0A120IXW0 A0A1S1BCL5 A5U689 I6YE90 M8CJZ6 P0A5U5 P9WHJ2 P9WHJ3
gi|121638612|ref|YP_978836.1| gi|525675262|ref|YP_008226829.1| gi|383308496|ref|YP_005361307.1| gi|385992016|ref|YP_005910314.1| gi|253798182|ref|YP_003031183.1| gi|31793909|ref|NP_856402.1| gi|506927275|ref|YP_008007725.1| gi|479315691|ref|YP_007855743.1| gi|375295450|ref|YP_005099717.1| gi|506927275|ref|YP_008007725.1| gi|148662578|ref|YP_001284101.1| gi|15609874|ref|NP_217253.1| gi|392387369|ref|YP_005308998.1| rv2737c gi|15842276|ref|NP_337313.1| gi|378772467|ref|YP_005172200.1| 233413.Mb2756c 336982.TBFG_12750 410289.BCG_2750c 419947.MRA_2763 478434.TBMG_01239 561275.JTY_2744 83331.MT2806 83332.Rv2737c gi|449064804|ref|YP_007431887.1| gi|224991104|ref|YP_002645793.1| gi|15609874|ref|NP_217253.1| gi|479056700|ref|YP_007352506.1| gi|148823925|ref|YP_001288679.1| gi|197738382|ref|YP_002159697.1| gi|471338742|ref|YP_007611455.1| gi|494701168|ref|YP_007966650.1| NP_217253.1.84033 WP_003414006.1.100000 WP_003414006.1.100021 WP_003414006.1.100069 WP_003414006.1.100087 WP_003414006.1.10015 WP_003414006.1.100208 WP_003414006.1.100216 WP_003414006.1.10022 WP_003414006.1.100255 WP_003414006.1.100260 WP_003414006.1.100270 WP_003414006.1.100279 WP_003414006.1.100286 WP_003414006.1.100308 WP_003414006.1.100309 WP_003414006.1.100318 WP_003414006.1.100337 WP_003414006.1.100338 WP_003414006.1.100383 WP_003414006.1.100396 WP_003414006.1.1004 WP_003414006.1.100401 WP_003414006.1.100459 WP_003414006.1.100460 WP_003414006.1.100552 WP_003414006.1.100581 WP_003414006.1.100600 WP_003414006.1.100625 WP_003414006.1.10064 WP_003414006.1.100666 WP_003414006.1.100671 WP_003414006.1.100677 WP_003414006.1.100682 WP_003414006.1.100697 WP_003414006.1.100703 WP_003414006.1.100716 WP_003414006.1.100722 WP_003414006.1.100754 WP_003414006.1.100757 WP_003414006.1.100772 WP_003414006.1.1008 WP_003414006.1.100812 WP_003414006.1.100845 WP_003414006.1.100866 WP_003414006.1.10088 WP_003414006.1.100889 WP_003414006.1.10090 WP_003414006.1.100910 WP_003414006.1.100915 WP_003414006.1.100918 WP_003414006.1.100935 WP_003414006.1.100984 WP_003414006.1.100992 WP_003414006.1.100998 WP_003414006.1.101 WP_003414006.1.101025 WP_003414006.1.101028 WP_003414006.1.10104 WP_003414006.1.101048 WP_003414006.1.101054 WP_003414006.1.101075 WP_003414006.1.101143 WP_003414006.1.101146 WP_003414006.1.10116 WP_003414006.1.10117 WP_003414006.1.101209 WP_003414006.1.10125 WP_003414006.1.101290 WP_003414006.1.101323 WP_003414006.1.101324 WP_003414006.1.101350 WP_003414006.1.101367 WP_003414006.1.101398 WP_003414006.1.101403 WP_003414006.1.101421 WP_003414006.1.10144 WP_003414006.1.101442 WP_003414006.1.10145 WP_003414006.1.101452 WP_003414006.1.101456 WP_003414006.1.101481 WP_003414006.1.101493 WP_003414006.1.101496 WP_003414006.1.101525 WP_003414006.1.101533 WP_003414006.1.101535 WP_003414006.1.101553 WP_003414006.1.101558 WP_003414006.1.10156 WP_003414006.1.101573 WP_003414006.1.101576 WP_003414006.1.10159 WP_003414006.1.101592 WP_003414006.1.101604 WP_003414006.1.101607 WP_003414006.1.101622 WP_003414006.1.101644 WP_003414006.1.101659 WP_003414006.1.101671 WP_003414006.1.101687 WP_003414006.1.101698 WP_003414006.1.10170 WP_003414006.1.101713 WP_003414006.1.101722 WP_003414006.1.101733 WP_003414006.1.101743 WP_003414006.1.101753 WP_003414006.1.101764 WP_003414006.1.101773 WP_003414006.1.101795 WP_003414006.1.101797 WP_003414006.1.101798 WP_003414006.1.101802 WP_003414006.1.101826 WP_003414006.1.101836 WP_003414006.1.101858 WP_003414006.1.101862 WP_003414006.1.101888 WP_003414006.1.101894 WP_003414006.1.101899 WP_003414006.1.1019 WP_003414006.1.101923 WP_003414006.1.101925 WP_003414006.1.10193 WP_003414006.1.101996 WP_003414006.1.102 WP_003414006.1.102008 WP_003414006.1.102017 WP_003414006.1.102053 WP_003414006.1.102055 WP_003414006.1.102063 WP_003414006.1.102099 WP_003414006.1.1021 WP_003414006.1.10211 WP_003414006.1.102119 WP_003414006.1.102121 WP_003414006.1.102143 WP_003414006.1.10216 WP_003414006.1.10224 WP_003414006.1.10253 WP_003414006.1.10262 WP_003414006.1.10272 WP_003414006.1.10277 WP_003414006.1.1033 WP_003414006.1.10350 WP_003414006.1.10362 WP_003414006.1.10366 WP_003414006.1.10376 WP_003414006.1.10396 WP_003414006.1.10410 WP_003414006.1.10414 WP_003414006.1.10430 WP_003414006.1.1044 WP_003414006.1.10440 WP_003414006.1.10445 WP_003414006.1.10471 WP_003414006.1.10472 WP_003414006.1.10489 WP_003414006.1.105 WP_003414006.1.10518 WP_003414006.1.10523 WP_003414006.1.10545 WP_003414006.1.1057 WP_003414006.1.10594 WP_003414006.1.10603 WP_003414006.1.10606 WP_003414006.1.10615 WP_003414006.1.10635 WP_003414006.1.10643 WP_003414006.1.10648 WP_003414006.1.10662 WP_003414006.1.10709 WP_003414006.1.10735 WP_003414006.1.10740 WP_003414006.1.10756 WP_003414006.1.1078 WP_003414006.1.10791 WP_003414006.1.10799 WP_003414006.1.10825 WP_003414006.1.10848 WP_003414006.1.10863 WP_003414006.1.10879 WP_003414006.1.10912 WP_003414006.1.10916 WP_003414006.1.10923 WP_003414006.1.10927 WP_003414006.1.1095 WP_003414006.1.10956 WP_003414006.1.10958 WP_003414006.1.10962 WP_003414006.1.10980 WP_003414006.1.10981 WP_003414006.1.10993 WP_003414006.1.1100 WP_003414006.1.11040 WP_003414006.1.11070 WP_003414006.1.11141 WP_003414006.1.11171 WP_003414006.1.11175 WP_003414006.1.11176 WP_003414006.1.11222 WP_003414006.1.11236 WP_003414006.1.11329 WP_003414006.1.1133 WP_003414006.1.11342 WP_003414006.1.11373 WP_003414006.1.11376 WP_003414006.1.11390 WP_003414006.1.11402 WP_003414006.1.11481 WP_003414006.1.11487 WP_003414006.1.11489 WP_003414006.1.11491 WP_003414006.1.11514 WP_003414006.1.11587 WP_003414006.1.11589 WP_003414006.1.11596 WP_003414006.1.11604 WP_003414006.1.11610 WP_003414006.1.11697 WP_003414006.1.11707 WP_003414006.1.11758 WP_003414006.1.11761 WP_003414006.1.11775 WP_003414006.1.11804 WP_003414006.1.11822 WP_003414006.1.11826 WP_003414006.1.11856 WP_003414006.1.11898 WP_003414006.1.11906 WP_003414006.1.11939 WP_003414006.1.11960 WP_003414006.1.11961 WP_003414006.1.11972 WP_003414006.1.11984 WP_003414006.1.120 WP_003414006.1.12001 WP_003414006.1.12049 WP_003414006.1.12052 WP_003414006.1.12100 WP_003414006.1.12116 WP_003414006.1.12130 WP_003414006.1.12133 WP_003414006.1.12161 WP_003414006.1.12165 WP_003414006.1.12184 WP_003414006.1.12187 WP_003414006.1.12190 WP_003414006.1.12216 WP_003414006.1.12265 WP_003414006.1.12275 WP_003414006.1.12293 WP_003414006.1.12294 WP_003414006.1.123 WP_003414006.1.1231 WP_003414006.1.12314 WP_003414006.1.12327 WP_003414006.1.12338 WP_003414006.1.1236 WP_003414006.1.12371 WP_003414006.1.12372 WP_003414006.1.12389 WP_003414006.1.12406 WP_003414006.1.1241 WP_003414006.1.12424 WP_003414006.1.12446 WP_003414006.1.12464 WP_003414006.1.12479 WP_003414006.1.12519 WP_003414006.1.12523 WP_003414006.1.12526 WP_003414006.1.1255 WP_003414006.1.12550 WP_003414006.1.12551 WP_003414006.1.12611 WP_003414006.1.12669 WP_003414006.1.1267 WP_003414006.1.12672 WP_003414006.1.12692 WP_003414006.1.1271 WP_003414006.1.12710 WP_003414006.1.12768 WP_003414006.1.1279 WP_003414006.1.12794 WP_003414006.1.12801 WP_003414006.1.12804 WP_003414006.1.12821 WP_003414006.1.12841 WP_003414006.1.12854 WP_003414006.1.12871 WP_003414006.1.12901 WP_003414006.1.12941 WP_003414006.1.12947 WP_003414006.1.12957 WP_003414006.1.12972 WP_003414006.1.13028 WP_003414006.1.13043 WP_003414006.1.13086 WP_003414006.1.13087 WP_003414006.1.13090 WP_003414006.1.13096 WP_003414006.1.13163 WP_003414006.1.13175 WP_003414006.1.13183 WP_003414006.1.132 WP_003414006.1.13249 WP_003414006.1.13282 WP_003414006.1.13284 WP_003414006.1.13296 WP_003414006.1.13298 WP_003414006.1.13302 WP_003414006.1.13306 WP_003414006.1.13312 WP_003414006.1.13313 WP_003414006.1.13321 WP_003414006.1.13345 WP_003414006.1.13358 WP_003414006.1.13370 WP_003414006.1.13375 WP_003414006.1.1338 WP_003414006.1.13420 WP_003414006.1.13433 WP_003414006.1.13435 WP_003414006.1.13438 WP_003414006.1.13461 WP_003414006.1.13466 WP_003414006.1.13489 WP_003414006.1.13526 WP_003414006.1.13551 WP_003414006.1.13564 WP_003414006.1.13579 WP_003414006.1.13647 WP_003414006.1.13687 WP_003414006.1.13697 WP_003414006.1.13719 WP_003414006.1.13763 WP_003414006.1.1377 WP_003414006.1.13774 WP_003414006.1.13786 WP_003414006.1.13793 WP_003414006.1.13794 WP_003414006.1.13817 WP_003414006.1.13834 WP_003414006.1.13880 WP_003414006.1.13899 WP_003414006.1.13909 WP_003414006.1.13919 WP_003414006.1.13920 WP_003414006.1.13952 WP_003414006.1.13953 WP_003414006.1.13962 WP_003414006.1.1398 WP_003414006.1.13988 WP_003414006.1.14027 WP_003414006.1.14046 WP_003414006.1.14115 WP_003414006.1.1415 WP_003414006.1.14152 WP_003414006.1.14158 WP_003414006.1.14162 WP_003414006.1.14175 WP_003414006.1.14178 WP_003414006.1.14194 WP_003414006.1.14195 WP_003414006.1.14208 WP_003414006.1.14238 WP_003414006.1.14266 WP_003414006.1.14273 WP_003414006.1.14303 WP_003414006.1.14306 WP_003414006.1.14307 WP_003414006.1.14310 WP_003414006.1.14341 WP_003414006.1.14382 WP_003414006.1.14416 WP_003414006.1.14428 WP_003414006.1.14441 WP_003414006.1.14469 WP_003414006.1.14477 WP_003414006.1.14504 WP_003414006.1.14514 WP_003414006.1.1452 WP_003414006.1.14527 WP_003414006.1.1454 WP_003414006.1.14544 WP_003414006.1.14548 WP_003414006.1.14551 WP_003414006.1.14561 WP_003414006.1.14573 WP_003414006.1.1462 WP_003414006.1.14658 WP_003414006.1.14667 WP_003414006.1.14668 WP_003414006.1.14675 WP_003414006.1.14694 WP_003414006.1.14695 WP_003414006.1.14709 WP_003414006.1.14766 WP_003414006.1.14783 WP_003414006.1.14865 WP_003414006.1.14872 WP_003414006.1.14905 WP_003414006.1.14926 WP_003414006.1.14951 WP_003414006.1.14955 WP_003414006.1.15003 WP_003414006.1.15009 WP_003414006.1.15028 WP_003414006.1.15040 WP_003414006.1.15052 WP_003414006.1.15065 WP_003414006.1.15072 WP_003414006.1.15089 WP_003414006.1.1509 WP_003414006.1.15126 WP_003414006.1.15131 WP_003414006.1.15168 WP_003414006.1.15172 WP_003414006.1.15174 WP_003414006.1.15187 WP_003414006.1.15196 WP_003414006.1.15210 WP_003414006.1.15216 WP_003414006.1.15217 WP_003414006.1.1523 WP_003414006.1.15232 WP_003414006.1.15238 WP_003414006.1.15240 WP_003414006.1.15253 WP_003414006.1.15267 WP_003414006.1.1527 WP_003414006.1.15292 WP_003414006.1.15299 WP_003414006.1.15302 WP_003414006.1.15322 WP_003414006.1.1534 WP_003414006.1.15345 WP_003414006.1.15365 WP_003414006.1.15372 WP_003414006.1.15386 WP_003414006.1.15387 WP_003414006.1.15442 WP_003414006.1.15447 WP_003414006.1.15449 WP_003414006.1.15477 WP_003414006.1.15481 WP_003414006.1.15492 WP_003414006.1.15511 WP_003414006.1.15512 WP_003414006.1.15558 WP_003414006.1.15559 WP_003414006.1.15566 WP_003414006.1.15599 WP_003414006.1.1560 WP_003414006.1.15611 WP_003414006.1.1563 WP_003414006.1.15633 WP_003414006.1.15643 WP_003414006.1.15688 WP_003414006.1.15755 WP_003414006.1.15763 WP_003414006.1.15774 WP_003414006.1.1578 WP_003414006.1.15780 WP_003414006.1.15827 WP_003414006.1.15834 WP_003414006.1.15842 WP_003414006.1.15853 WP_003414006.1.15870 WP_003414006.1.15877 WP_003414006.1.15893 WP_003414006.1.15896 WP_003414006.1.15926 WP_003414006.1.15933 WP_003414006.1.15946 WP_003414006.1.15958 WP_003414006.1.15973 WP_003414006.1.15987 WP_003414006.1.15993 WP_003414006.1.16009 WP_003414006.1.16025 WP_003414006.1.16043 WP_003414006.1.16066 WP_003414006.1.16069 WP_003414006.1.16077 WP_003414006.1.16106 WP_003414006.1.16108 WP_003414006.1.16130 WP_003414006.1.16136 WP_003414006.1.16139 WP_003414006.1.16141 WP_003414006.1.16143 WP_003414006.1.1630 WP_003414006.1.16318 WP_003414006.1.1632 WP_003414006.1.16327 WP_003414006.1.16334 WP_003414006.1.16341 WP_003414006.1.16345 WP_003414006.1.16374 WP_003414006.1.16384 WP_003414006.1.16386 WP_003414006.1.164 WP_003414006.1.1642 WP_003414006.1.16424 WP_003414006.1.16426 WP_003414006.1.16431 WP_003414006.1.16438 WP_003414006.1.1644 WP_003414006.1.16442 WP_003414006.1.16448 WP_003414006.1.16451 WP_003414006.1.16476 WP_003414006.1.16480 WP_003414006.1.16494 WP_003414006.1.1652 WP_003414006.1.16549 WP_003414006.1.16560 WP_003414006.1.16598 WP_003414006.1.16619 WP_003414006.1.16620 WP_003414006.1.16622 WP_003414006.1.16637 WP_003414006.1.16707 WP_003414006.1.16724 WP_003414006.1.16731 WP_003414006.1.16743 WP_003414006.1.1683 WP_003414006.1.16837 WP_003414006.1.16852 WP_003414006.1.16937 WP_003414006.1.16940 WP_003414006.1.16950 WP_003414006.1.16959 WP_003414006.1.16968 WP_003414006.1.1697 WP_003414006.1.16973 WP_003414006.1.16977 WP_003414006.1.16987 WP_003414006.1.17005 WP_003414006.1.17006 WP_003414006.1.17010 WP_003414006.1.17015 WP_003414006.1.17019 WP_003414006.1.17039 WP_003414006.1.17041 WP_003414006.1.17052 WP_003414006.1.17057 WP_003414006.1.17062 WP_003414006.1.1707 WP_003414006.1.17094 WP_003414006.1.17138 WP_003414006.1.17147 WP_003414006.1.17167 WP_003414006.1.17224 WP_003414006.1.17251 WP_003414006.1.17288 WP_003414006.1.17304 WP_003414006.1.17314 WP_003414006.1.17345 WP_003414006.1.17381 WP_003414006.1.17391 WP_003414006.1.17412 WP_003414006.1.1743 WP_003414006.1.17440 WP_003414006.1.17466 WP_003414006.1.17477 WP_003414006.1.17483 WP_003414006.1.17505 WP_003414006.1.17527 WP_003414006.1.17535 WP_003414006.1.17540 WP_003414006.1.17553 WP_003414006.1.17558 WP_003414006.1.17599 WP_003414006.1.17635 WP_003414006.1.17655 WP_003414006.1.17679 WP_003414006.1.1768 WP_003414006.1.17687 WP_003414006.1.17700 WP_003414006.1.17710 WP_003414006.1.17713 WP_003414006.1.17722 WP_003414006.1.17746 WP_003414006.1.17788 WP_003414006.1.17798 WP_003414006.1.17803 WP_003414006.1.17816 WP_003414006.1.17821 WP_003414006.1.17830 WP_003414006.1.17868 WP_003414006.1.17878 WP_003414006.1.1792 WP_003414006.1.17923 WP_003414006.1.1795 WP_003414006.1.17955 WP_003414006.1.17973 WP_003414006.1.18009 WP_003414006.1.18013 WP_003414006.1.18033 WP_003414006.1.18057 WP_003414006.1.18065 WP_003414006.1.18070 WP_003414006.1.18116 WP_003414006.1.18120 WP_003414006.1.18126 WP_003414006.1.1817 WP_003414006.1.18170 WP_003414006.1.18206 WP_003414006.1.18216 WP_003414006.1.18240 WP_003414006.1.18257 WP_003414006.1.18297 WP_003414006.1.18306 WP_003414006.1.18364 WP_003414006.1.18399 WP_003414006.1.18411 WP_003414006.1.18444 WP_003414006.1.18448 WP_003414006.1.18467 WP_003414006.1.18476 WP_003414006.1.18522 WP_003414006.1.18580 WP_003414006.1.18582 WP_003414006.1.18587 WP_003414006.1.186 WP_003414006.1.18601 WP_003414006.1.18639 WP_003414006.1.18646 WP_003414006.1.18647 WP_003414006.1.1868 WP_003414006.1.18694 WP_003414006.1.18710 WP_003414006.1.18751 WP_003414006.1.18781 WP_003414006.1.18793 WP_003414006.1.18804 WP_003414006.1.18816 WP_003414006.1.18823 WP_003414006.1.18827 WP_003414006.1.18838 WP_003414006.1.18849 WP_003414006.1.18856 WP_003414006.1.18945 WP_003414006.1.1898 WP_003414006.1.19005 WP_003414006.1.19063 WP_003414006.1.19066 WP_003414006.1.19071 WP_003414006.1.19085 WP_003414006.1.19094 WP_003414006.1.19144 WP_003414006.1.19159 WP_003414006.1.19193 WP_003414006.1.19231 WP_003414006.1.19243 WP_003414006.1.19264 WP_003414006.1.19295 WP_003414006.1.19307 WP_003414006.1.19326 WP_003414006.1.1933 WP_003414006.1.19364 WP_003414006.1.19382 WP_003414006.1.19400 WP_003414006.1.19426 WP_003414006.1.19429 WP_003414006.1.19464 WP_003414006.1.19480 WP_003414006.1.19512 WP_003414006.1.19553 WP_003414006.1.19562 WP_003414006.1.19564 WP_003414006.1.19568 WP_003414006.1.19572 WP_003414006.1.19595 WP_003414006.1.19596 WP_003414006.1.19600 WP_003414006.1.19630 WP_003414006.1.1967 WP_003414006.1.19694 WP_003414006.1.1970 WP_003414006.1.19707 WP_003414006.1.19742 WP_003414006.1.19785 WP_003414006.1.19820 WP_003414006.1.19868 WP_003414006.1.19874 WP_003414006.1.19890 WP_003414006.1.19900 WP_003414006.1.19922 WP_003414006.1.19936 WP_003414006.1.19946 WP_003414006.1.19949 WP_003414006.1.19960 WP_003414006.1.19964 WP_003414006.1.20007 WP_003414006.1.20016 WP_003414006.1.20028 WP_003414006.1.2003 WP_003414006.1.20037 WP_003414006.1.20039 WP_003414006.1.20082 WP_003414006.1.20085 WP_003414006.1.20097 WP_003414006.1.20116 WP_003414006.1.20130 WP_003414006.1.20141 WP_003414006.1.20142 WP_003414006.1.20158 WP_003414006.1.20239 WP_003414006.1.20243 WP_003414006.1.20259 WP_003414006.1.20262 WP_003414006.1.20268 WP_003414006.1.20272 WP_003414006.1.20280 WP_003414006.1.20294 WP_003414006.1.20300 WP_003414006.1.20309 WP_003414006.1.20322 WP_003414006.1.2037 WP_003414006.1.20372 WP_003414006.1.20381 WP_003414006.1.204 WP_003414006.1.20427 WP_003414006.1.20457 WP_003414006.1.20459 WP_003414006.1.20460 WP_003414006.1.20542 WP_003414006.1.20578 WP_003414006.1.20608 WP_003414006.1.20624 WP_003414006.1.20628 WP_003414006.1.2066 WP_003414006.1.20707 WP_003414006.1.20722 WP_003414006.1.20729 WP_003414006.1.20742 WP_003414006.1.20751 WP_003414006.1.20776 WP_003414006.1.20843 WP_003414006.1.20850 WP_003414006.1.2086 WP_003414006.1.20868 WP_003414006.1.20876 WP_003414006.1.20897 WP_003414006.1.20898 WP_003414006.1.2090 WP_003414006.1.20911 WP_003414006.1.20916 WP_003414006.1.20921 WP_003414006.1.20926 WP_003414006.1.20927 WP_003414006.1.20951 WP_003414006.1.20970 WP_003414006.1.2104 WP_003414006.1.21127 WP_003414006.1.21135 WP_003414006.1.21173 WP_003414006.1.21187 WP_003414006.1.212 WP_003414006.1.2120 WP_003414006.1.21218 WP_003414006.1.21219 WP_003414006.1.2123 WP_003414006.1.21231 WP_003414006.1.21234 WP_003414006.1.2126 WP_003414006.1.21292 WP_003414006.1.21307 WP_003414006.1.2131 WP_003414006.1.21311 WP_003414006.1.21321 WP_003414006.1.21365 WP_003414006.1.21392 WP_003414006.1.21397 WP_003414006.1.21403 WP_003414006.1.21415 WP_003414006.1.21418 WP_003414006.1.21430 WP_003414006.1.21434 WP_003414006.1.21444 WP_003414006.1.21468 WP_003414006.1.21498 WP_003414006.1.21509 WP_003414006.1.21513 WP_003414006.1.21560 WP_003414006.1.21565 WP_003414006.1.21586 WP_003414006.1.21591 WP_003414006.1.21594 WP_003414006.1.21602 WP_003414006.1.21615 WP_003414006.1.21638 WP_003414006.1.21639 WP_003414006.1.21655 WP_003414006.1.21658 WP_003414006.1.2168 WP_003414006.1.2174 WP_003414006.1.21741 WP_003414006.1.21742 WP_003414006.1.21777 WP_003414006.1.21786 WP_003414006.1.21795 WP_003414006.1.218 WP_003414006.1.21826 WP_003414006.1.21829 WP_003414006.1.21840 WP_003414006.1.21843 WP_003414006.1.21872 WP_003414006.1.21873 WP_003414006.1.2188 WP_003414006.1.21882 WP_003414006.1.21906 WP_003414006.1.21912 WP_003414006.1.2194 WP_003414006.1.21941 WP_003414006.1.21956 WP_003414006.1.21958 WP_003414006.1.21960 WP_003414006.1.21971 WP_003414006.1.21973 WP_003414006.1.21983 WP_003414006.1.22003 WP_003414006.1.22013 WP_003414006.1.22025 WP_003414006.1.22036 WP_003414006.1.22075 WP_003414006.1.22092 WP_003414006.1.2212 WP_003414006.1.22127 WP_003414006.1.22140 WP_003414006.1.22233 WP_003414006.1.22255 WP_003414006.1.22277 WP_003414006.1.22305 WP_003414006.1.22348 WP_003414006.1.22356 WP_003414006.1.22366 WP_003414006.1.2238 WP_003414006.1.22380 WP_003414006.1.22437 WP_003414006.1.22438 WP_003414006.1.22445 WP_003414006.1.22490 WP_003414006.1.22511 WP_003414006.1.22524 WP_003414006.1.2253 WP_003414006.1.22585 WP_003414006.1.22606 WP_003414006.1.22608 WP_003414006.1.22609 WP_003414006.1.22618 WP_003414006.1.2262 WP_003414006.1.22624 WP_003414006.1.22629 WP_003414006.1.22647 WP_003414006.1.22664 WP_003414006.1.22665 WP_003414006.1.22670 WP_003414006.1.22674 WP_003414006.1.22680 WP_003414006.1.22725 WP_003414006.1.22728 WP_003414006.1.22733 WP_003414006.1.22737 WP_003414006.1.22754 WP_003414006.1.22800 WP_003414006.1.22804 WP_003414006.1.22829 WP_003414006.1.22840 WP_003414006.1.22844 WP_003414006.1.22963 WP_003414006.1.22970 WP_003414006.1.22996 WP_003414006.1.22997 WP_003414006.1.22999 WP_003414006.1.23015 WP_003414006.1.23032 WP_003414006.1.231 WP_003414006.1.23101 WP_003414006.1.2312 WP_003414006.1.23140 WP_003414006.1.23153 WP_003414006.1.23171 WP_003414006.1.23199 WP_003414006.1.2320 WP_003414006.1.23204 WP_003414006.1.23216 WP_003414006.1.23229 WP_003414006.1.23233 WP_003414006.1.2326 WP_003414006.1.23261 WP_003414006.1.23272 WP_003414006.1.23289 WP_003414006.1.2329 WP_003414006.1.23308 WP_003414006.1.23316 WP_003414006.1.23321 WP_003414006.1.23325 WP_003414006.1.2339 WP_003414006.1.23406 WP_003414006.1.23438 WP_003414006.1.23445 WP_003414006.1.23447 WP_003414006.1.23452 WP_003414006.1.23461 WP_003414006.1.2349 WP_003414006.1.23496 WP_003414006.1.23497 WP_003414006.1.23506 WP_003414006.1.23530 WP_003414006.1.23539 WP_003414006.1.23546 WP_003414006.1.23551 WP_003414006.1.23573 WP_003414006.1.23583 WP_003414006.1.23588 WP_003414006.1.23628 WP_003414006.1.23677 WP_003414006.1.23683 WP_003414006.1.23692 WP_003414006.1.23694 WP_003414006.1.23699 WP_003414006.1.2371 WP_003414006.1.23803 WP_003414006.1.23807 WP_003414006.1.23825 WP_003414006.1.23832 WP_003414006.1.2384 WP_003414006.1.23843 WP_003414006.1.23863 WP_003414006.1.2387 WP_003414006.1.23894 WP_003414006.1.23993 WP_003414006.1.2400 WP_003414006.1.24007 WP_003414006.1.24008 WP_003414006.1.24046 WP_003414006.1.24057 WP_003414006.1.24062 WP_003414006.1.24113 WP_003414006.1.24119 WP_003414006.1.24140 WP_003414006.1.24176 WP_003414006.1.24190 WP_003414006.1.24202 WP_003414006.1.24261 WP_003414006.1.24284 WP_003414006.1.24294 WP_003414006.1.24357 WP_003414006.1.24396 WP_003414006.1.24414 WP_003414006.1.24423 WP_003414006.1.2443 WP_003414006.1.24446 WP_003414006.1.24461 WP_003414006.1.24500 WP_003414006.1.24507 WP_003414006.1.24509 WP_003414006.1.24529 WP_003414006.1.24553 WP_003414006.1.24599 WP_003414006.1.24638 WP_003414006.1.2466 WP_003414006.1.24824 WP_003414006.1.24831 WP_003414006.1.24840 WP_003414006.1.24848 WP_003414006.1.24857 WP_003414006.1.2487 WP_003414006.1.24893 WP_003414006.1.24907 WP_003414006.1.24933 WP_003414006.1.24956 WP_003414006.1.24958 WP_003414006.1.24985 WP_003414006.1.2499 WP_003414006.1.25004 WP_003414006.1.2505 WP_003414006.1.25051 WP_003414006.1.2507 WP_003414006.1.25103 WP_003414006.1.25129 WP_003414006.1.25171 WP_003414006.1.25184 WP_003414006.1.25247 WP_003414006.1.25252 WP_003414006.1.25278 WP_003414006.1.25283 WP_003414006.1.25309 WP_003414006.1.25313 WP_003414006.1.25338 WP_003414006.1.25342 WP_003414006.1.25343 WP_003414006.1.25367 WP_003414006.1.25393 WP_003414006.1.25406 WP_003414006.1.25435 WP_003414006.1.25437 WP_003414006.1.25445 WP_003414006.1.25455 WP_003414006.1.25473 WP_003414006.1.25504 WP_003414006.1.25513 WP_003414006.1.25542 WP_003414006.1.25579 WP_003414006.1.25594 WP_003414006.1.25606 WP_003414006.1.25645 WP_003414006.1.2566 WP_003414006.1.25673 WP_003414006.1.25674 WP_003414006.1.25693 WP_003414006.1.25699 WP_003414006.1.25727 WP_003414006.1.25736 WP_003414006.1.25738 WP_003414006.1.25756 WP_003414006.1.25759 WP_003414006.1.2580 WP_003414006.1.25813 WP_003414006.1.25854 WP_003414006.1.25874 WP_003414006.1.25885 WP_003414006.1.25892 WP_003414006.1.25906 WP_003414006.1.25914 WP_003414006.1.25916 WP_003414006.1.2594 WP_003414006.1.25954 WP_003414006.1.25965 WP_003414006.1.25972 WP_003414006.1.26017 WP_003414006.1.26032 WP_003414006.1.26072 WP_003414006.1.26089 WP_003414006.1.26097 WP_003414006.1.26098 WP_003414006.1.26108 WP_003414006.1.26109 WP_003414006.1.26118 WP_003414006.1.26126 WP_003414006.1.2614 WP_003414006.1.26168 WP_003414006.1.26182 WP_003414006.1.26190 WP_003414006.1.2620 WP_003414006.1.26234 WP_003414006.1.26243 WP_003414006.1.26265 WP_003414006.1.26267 WP_003414006.1.26292 WP_003414006.1.26310 WP_003414006.1.26328 WP_003414006.1.26349 WP_003414006.1.26366 WP_003414006.1.26374 WP_003414006.1.26407 WP_003414006.1.26412 WP_003414006.1.26454 WP_003414006.1.26464 WP_003414006.1.2653 WP_003414006.1.26560 WP_003414006.1.26571 WP_003414006.1.2659 WP_003414006.1.26597 WP_003414006.1.26603 WP_003414006.1.26629 WP_003414006.1.26651 WP_003414006.1.26702 WP_003414006.1.26707 WP_003414006.1.26710 WP_003414006.1.26719 WP_003414006.1.26737 WP_003414006.1.26738 WP_003414006.1.26745 WP_003414006.1.26756 WP_003414006.1.2676 WP_003414006.1.2677 WP_003414006.1.26779 WP_003414006.1.26780 WP_003414006.1.26854 WP_003414006.1.26868 WP_003414006.1.26876 WP_003414006.1.26888 WP_003414006.1.26914 WP_003414006.1.26945 WP_003414006.1.26959 WP_003414006.1.26969 WP_003414006.1.26984 WP_003414006.1.26992 WP_003414006.1.27017 WP_003414006.1.27045 WP_003414006.1.27074 WP_003414006.1.27075 WP_003414006.1.27128 WP_003414006.1.27130 WP_003414006.1.27139 WP_003414006.1.27152 WP_003414006.1.27162 WP_003414006.1.27164 WP_003414006.1.27193 WP_003414006.1.27235 WP_003414006.1.27254 WP_003414006.1.27278 WP_003414006.1.27343 WP_003414006.1.27352 WP_003414006.1.27369 WP_003414006.1.27391 WP_003414006.1.27398 WP_003414006.1.27402 WP_003414006.1.27410 WP_003414006.1.27411 WP_003414006.1.27449 WP_003414006.1.27460 WP_003414006.1.27463 WP_003414006.1.2749 WP_003414006.1.27492 WP_003414006.1.27528 WP_003414006.1.27541 WP_003414006.1.27576 WP_003414006.1.27582 WP_003414006.1.27596 WP_003414006.1.27607 WP_003414006.1.2766 WP_003414006.1.277 WP_003414006.1.27724 WP_003414006.1.27730 WP_003414006.1.27736 WP_003414006.1.27743 WP_003414006.1.27750 WP_003414006.1.27771 WP_003414006.1.27779 WP_003414006.1.27795 WP_003414006.1.27803 WP_003414006.1.27819 WP_003414006.1.27915 WP_003414006.1.27935 WP_003414006.1.27962 WP_003414006.1.28053 WP_003414006.1.28092 WP_003414006.1.28131 WP_003414006.1.28159 WP_003414006.1.2816 WP_003414006.1.28161 WP_003414006.1.28192 WP_003414006.1.28202 WP_003414006.1.28241 WP_003414006.1.28242 WP_003414006.1.28251 WP_003414006.1.28255 WP_003414006.1.28269 WP_003414006.1.28276 WP_003414006.1.28293 WP_003414006.1.28331 WP_003414006.1.28367 WP_003414006.1.28378 WP_003414006.1.28391 WP_003414006.1.2842 WP_003414006.1.28448 WP_003414006.1.2847 WP_003414006.1.28471 WP_003414006.1.28473 WP_003414006.1.28493 WP_003414006.1.28497 WP_003414006.1.28530 WP_003414006.1.28545 WP_003414006.1.28561 WP_003414006.1.28567 WP_003414006.1.28585 WP_003414006.1.286 WP_003414006.1.28610 WP_003414006.1.28617 WP_003414006.1.28634 WP_003414006.1.28642 WP_003414006.1.28671 WP_003414006.1.28682 WP_003414006.1.28698 WP_003414006.1.28703 WP_003414006.1.28739 WP_003414006.1.28781 WP_003414006.1.28787 WP_003414006.1.28827 WP_003414006.1.28839 WP_003414006.1.28847 WP_003414006.1.28850 WP_003414006.1.28851 WP_003414006.1.28865 WP_003414006.1.28897 WP_003414006.1.28914 WP_003414006.1.28935 WP_003414006.1.28936 WP_003414006.1.28939 WP_003414006.1.28943 WP_003414006.1.28952 WP_003414006.1.28975 WP_003414006.1.2899 WP_003414006.1.28993 WP_003414006.1.29000 WP_003414006.1.2901 WP_003414006.1.29028 WP_003414006.1.29033 WP_003414006.1.29058 WP_003414006.1.29115 WP_003414006.1.2916 WP_003414006.1.29217 WP_003414006.1.29223 WP_003414006.1.29234 WP_003414006.1.29264 WP_003414006.1.29275 WP_003414006.1.29306 WP_003414006.1.29339 WP_003414006.1.29348 WP_003414006.1.29364 WP_003414006.1.29367 WP_003414006.1.29426 WP_003414006.1.2944 WP_003414006.1.29449 WP_003414006.1.29450 WP_003414006.1.29452 WP_003414006.1.2949 WP_003414006.1.29510 WP_003414006.1.29515 WP_003414006.1.29525 WP_003414006.1.2953 WP_003414006.1.29559 WP_003414006.1.29587 WP_003414006.1.2959 WP_003414006.1.29592 WP_003414006.1.29599 WP_003414006.1.29611 WP_003414006.1.29632 WP_003414006.1.29649 WP_003414006.1.2965 WP_003414006.1.29659 WP_003414006.1.2969 WP_003414006.1.29698 WP_003414006.1.29718 WP_003414006.1.29745 WP_003414006.1.29747 WP_003414006.1.29769 WP_003414006.1.29825 WP_003414006.1.29830 WP_003414006.1.29847 WP_003414006.1.29861 WP_003414006.1.29869 WP_003414006.1.29883 WP_003414006.1.29890 WP_003414006.1.299 WP_003414006.1.29931 WP_003414006.1.29960 WP_003414006.1.30014 WP_003414006.1.3004 WP_003414006.1.30040 WP_003414006.1.30043 WP_003414006.1.30074 WP_003414006.1.30101 WP_003414006.1.30106 WP_003414006.1.30114 WP_003414006.1.30126 WP_003414006.1.30131 WP_003414006.1.30138 WP_003414006.1.30139 WP_003414006.1.30145 WP_003414006.1.30224 WP_003414006.1.30235 WP_003414006.1.30237 WP_003414006.1.3027 WP_003414006.1.30279 WP_003414006.1.30282 WP_003414006.1.30283 WP_003414006.1.30288 WP_003414006.1.30291 WP_003414006.1.30363 WP_003414006.1.30374 WP_003414006.1.30404 WP_003414006.1.3043 WP_003414006.1.30433 WP_003414006.1.30438 WP_003414006.1.30464 WP_003414006.1.30468 WP_003414006.1.30500 WP_003414006.1.3057 WP_003414006.1.30574 WP_003414006.1.30628 WP_003414006.1.30641 WP_003414006.1.30642 WP_003414006.1.30661 WP_003414006.1.30669 WP_003414006.1.30683 WP_003414006.1.30699 WP_003414006.1.30709 WP_003414006.1.30713 WP_003414006.1.30716 WP_003414006.1.30719 WP_003414006.1.30730 WP_003414006.1.30732 WP_003414006.1.30736 WP_003414006.1.30760 WP_003414006.1.30791 WP_003414006.1.308 WP_003414006.1.30807 WP_003414006.1.30818 WP_003414006.1.30824 WP_003414006.1.30848 WP_003414006.1.30877 WP_003414006.1.30888 WP_003414006.1.30901 WP_003414006.1.30903 WP_003414006.1.30912 WP_003414006.1.30914 WP_003414006.1.30919 WP_003414006.1.30977 WP_003414006.1.3100 WP_003414006.1.31002 WP_003414006.1.3101 WP_003414006.1.31034 WP_003414006.1.31047 WP_003414006.1.31070 WP_003414006.1.31074 WP_003414006.1.31102 WP_003414006.1.31127 WP_003414006.1.31184 WP_003414006.1.31199 WP_003414006.1.31226 WP_003414006.1.31230 WP_003414006.1.31233 WP_003414006.1.31263 WP_003414006.1.31264 WP_003414006.1.31270 WP_003414006.1.31287 WP_003414006.1.31304 WP_003414006.1.31346 WP_003414006.1.31348 WP_003414006.1.31354 WP_003414006.1.31390 WP_003414006.1.31414 WP_003414006.1.31417 WP_003414006.1.31428 WP_003414006.1.3143 WP_003414006.1.31458 WP_003414006.1.31483 WP_003414006.1.3149 WP_003414006.1.31498 WP_003414006.1.31507 WP_003414006.1.31537 WP_003414006.1.31548 WP_003414006.1.31569 WP_003414006.1.31573 WP_003414006.1.316 WP_003414006.1.31629 WP_003414006.1.31666 WP_003414006.1.31693 WP_003414006.1.31703 WP_003414006.1.31744 WP_003414006.1.31770 WP_003414006.1.31776 WP_003414006.1.31783 WP_003414006.1.318 WP_003414006.1.3184 WP_003414006.1.31840 WP_003414006.1.31880 WP_003414006.1.31911 WP_003414006.1.31930 WP_003414006.1.31932 WP_003414006.1.31955 WP_003414006.1.31985 WP_003414006.1.31991 WP_003414006.1.31995 WP_003414006.1.32004 WP_003414006.1.32039 WP_003414006.1.3204 WP_003414006.1.32045 WP_003414006.1.32071 WP_003414006.1.32098 WP_003414006.1.32132 WP_003414006.1.32157 WP_003414006.1.32164 WP_003414006.1.32179 WP_003414006.1.32198 WP_003414006.1.32297 WP_003414006.1.32317 WP_003414006.1.32383 WP_003414006.1.32400 WP_003414006.1.32403 WP_003414006.1.32416 WP_003414006.1.32433 WP_003414006.1.32461 WP_003414006.1.32482 WP_003414006.1.32503 WP_003414006.1.32556 WP_003414006.1.32562 WP_003414006.1.32569 WP_003414006.1.32592 WP_003414006.1.32620 WP_003414006.1.32647 WP_003414006.1.32653 WP_003414006.1.32654 WP_003414006.1.3268 WP_003414006.1.32695 WP_003414006.1.32706 WP_003414006.1.32716 WP_003414006.1.32738 WP_003414006.1.32752 WP_003414006.1.32780 WP_003414006.1.32781 WP_003414006.1.32793 WP_003414006.1.32822 WP_003414006.1.32833 WP_003414006.1.32862 WP_003414006.1.32880 WP_003414006.1.32897 WP_003414006.1.32909 WP_003414006.1.32935 WP_003414006.1.32974 WP_003414006.1.33007 WP_003414006.1.3302 WP_003414006.1.33028 WP_003414006.1.33035 WP_003414006.1.33044 WP_003414006.1.33054 WP_003414006.1.33082 WP_003414006.1.33141 WP_003414006.1.33148 WP_003414006.1.33155 WP_003414006.1.33168 WP_003414006.1.3321 WP_003414006.1.33215 WP_003414006.1.3325 WP_003414006.1.3327 WP_003414006.1.33278 WP_003414006.1.33288 WP_003414006.1.33305 WP_003414006.1.3331 WP_003414006.1.33319 WP_003414006.1.3333 WP_003414006.1.33393 WP_003414006.1.33403 WP_003414006.1.33452 WP_003414006.1.33467 WP_003414006.1.33477 WP_003414006.1.3349 WP_003414006.1.33519 WP_003414006.1.33542 WP_003414006.1.33601 WP_003414006.1.33602 WP_003414006.1.33633 WP_003414006.1.33646 WP_003414006.1.33673 WP_003414006.1.3369 WP_003414006.1.33705 WP_003414006.1.33762 WP_003414006.1.33783 WP_003414006.1.33789 WP_003414006.1.3383 WP_003414006.1.33832 WP_003414006.1.33839 WP_003414006.1.33848 WP_003414006.1.3387 WP_003414006.1.33886 WP_003414006.1.33895 WP_003414006.1.33906 WP_003414006.1.33912 WP_003414006.1.33954 WP_003414006.1.3399 WP_003414006.1.34042 WP_003414006.1.3405 WP_003414006.1.34055 WP_003414006.1.34056 WP_003414006.1.34065 WP_003414006.1.3408 WP_003414006.1.34090 WP_003414006.1.34109 WP_003414006.1.34111 WP_003414006.1.34131 WP_003414006.1.34152 WP_003414006.1.34153 WP_003414006.1.34163 WP_003414006.1.34181 WP_003414006.1.34197 WP_003414006.1.34198 WP_003414006.1.34215 WP_003414006.1.34219 WP_003414006.1.34255 WP_003414006.1.34260 WP_003414006.1.34275 WP_003414006.1.343 WP_003414006.1.34347 WP_003414006.1.34358 WP_003414006.1.34392 WP_003414006.1.344 WP_003414006.1.34428 WP_003414006.1.3443 WP_003414006.1.34435 WP_003414006.1.34446 WP_003414006.1.34499 WP_003414006.1.34505 WP_003414006.1.34516 WP_003414006.1.34529 WP_003414006.1.34551 WP_003414006.1.34563 WP_003414006.1.34576 WP_003414006.1.34581 WP_003414006.1.34588 WP_003414006.1.34596 WP_003414006.1.34599 WP_003414006.1.34639 WP_003414006.1.34724 WP_003414006.1.34740 WP_003414006.1.34755 WP_003414006.1.34777 WP_003414006.1.34783 WP_003414006.1.34841 WP_003414006.1.34908 WP_003414006.1.34919 WP_003414006.1.3492 WP_003414006.1.34933 WP_003414006.1.34945 WP_003414006.1.34946 WP_003414006.1.34954 WP_003414006.1.34960 WP_003414006.1.34961 WP_003414006.1.34963 WP_003414006.1.34965 WP_003414006.1.34968 WP_003414006.1.35023 WP_003414006.1.35069 WP_003414006.1.35072 WP_003414006.1.35078 WP_003414006.1.35146 WP_003414006.1.35156 WP_003414006.1.35160 WP_003414006.1.35162 WP_003414006.1.35173 WP_003414006.1.35176 WP_003414006.1.3520 WP_003414006.1.35221 WP_003414006.1.35246 WP_003414006.1.35278 WP_003414006.1.35301 WP_003414006.1.35311 WP_003414006.1.35312 WP_003414006.1.35317 WP_003414006.1.35319 WP_003414006.1.35347 WP_003414006.1.35363 WP_003414006.1.35382 WP_003414006.1.35385 WP_003414006.1.35396 WP_003414006.1.35426 WP_003414006.1.35439 WP_003414006.1.35455 WP_003414006.1.3548 WP_003414006.1.35484 WP_003414006.1.35492 WP_003414006.1.3553 WP_003414006.1.35553 WP_003414006.1.35555 WP_003414006.1.35561 WP_003414006.1.35610 WP_003414006.1.35635 WP_003414006.1.35657 WP_003414006.1.35680 WP_003414006.1.35687 WP_003414006.1.35689 WP_003414006.1.35707 WP_003414006.1.35732 WP_003414006.1.35754 WP_003414006.1.35767 WP_003414006.1.35770 WP_003414006.1.35771 WP_003414006.1.35780 WP_003414006.1.35805 WP_003414006.1.35811 WP_003414006.1.35821 WP_003414006.1.3584 WP_003414006.1.35848 WP_003414006.1.35864 WP_003414006.1.35874 WP_003414006.1.35876 WP_003414006.1.35897 WP_003414006.1.35899 WP_003414006.1.3593 WP_003414006.1.35954 WP_003414006.1.36005 WP_003414006.1.36014 WP_003414006.1.36023 WP_003414006.1.36051 WP_003414006.1.36053 WP_003414006.1.36075 WP_003414006.1.36089 WP_003414006.1.36097 WP_003414006.1.36098 WP_003414006.1.36116 WP_003414006.1.36145 WP_003414006.1.36156 WP_003414006.1.36205 WP_003414006.1.36228 WP_003414006.1.36246 WP_003414006.1.36252 WP_003414006.1.36260 WP_003414006.1.36270 WP_003414006.1.36271 WP_003414006.1.36303 WP_003414006.1.36309 WP_003414006.1.36315 WP_003414006.1.36319 WP_003414006.1.36321 WP_003414006.1.36326 WP_003414006.1.3634 WP_003414006.1.36356 WP_003414006.1.36357 WP_003414006.1.3636 WP_003414006.1.36385 WP_003414006.1.36399 WP_003414006.1.36436 WP_003414006.1.36465 WP_003414006.1.36469 WP_003414006.1.36473 WP_003414006.1.36485 WP_003414006.1.36508 WP_003414006.1.36540 WP_003414006.1.36561 WP_003414006.1.36571 WP_003414006.1.36573 WP_003414006.1.36578 WP_003414006.1.36585 WP_003414006.1.36597 WP_003414006.1.36614 WP_003414006.1.36657 WP_003414006.1.36674 WP_003414006.1.36720 WP_003414006.1.36727 WP_003414006.1.36733 WP_003414006.1.36810 WP_003414006.1.36844 WP_003414006.1.36893 WP_003414006.1.36901 WP_003414006.1.36921 WP_003414006.1.36935 WP_003414006.1.36941 WP_003414006.1.3695 WP_003414006.1.36951 WP_003414006.1.36968 WP_003414006.1.3700 WP_003414006.1.37004 WP_003414006.1.37012 WP_003414006.1.37071 WP_003414006.1.37088 WP_003414006.1.37131 WP_003414006.1.37157 WP_003414006.1.37175 WP_003414006.1.37188 WP_003414006.1.37213 WP_003414006.1.37229 WP_003414006.1.3724 WP_003414006.1.37277 WP_003414006.1.37305 WP_003414006.1.37330 WP_003414006.1.37389 WP_003414006.1.37400 WP_003414006.1.37440 WP_003414006.1.37459 WP_003414006.1.37468 WP_003414006.1.37475 WP_003414006.1.37484 WP_003414006.1.37601 WP_003414006.1.37612 WP_003414006.1.37632 WP_003414006.1.37643 WP_003414006.1.37655 WP_003414006.1.37660 WP_003414006.1.37674 WP_003414006.1.37700 WP_003414006.1.37701 WP_003414006.1.37709 WP_003414006.1.37711 WP_003414006.1.37721 WP_003414006.1.37722 WP_003414006.1.37747 WP_003414006.1.37765 WP_003414006.1.37772 WP_003414006.1.37804 WP_003414006.1.37809 WP_003414006.1.37859 WP_003414006.1.37877 WP_003414006.1.37912 WP_003414006.1.37913 WP_003414006.1.37943 WP_003414006.1.37950 WP_003414006.1.37973 WP_003414006.1.37975 WP_003414006.1.37983 WP_003414006.1.38 WP_003414006.1.38002 WP_003414006.1.3802 WP_003414006.1.38039 WP_003414006.1.38040 WP_003414006.1.38067 WP_003414006.1.38068 WP_003414006.1.38135 WP_003414006.1.38138 WP_003414006.1.38144 WP_003414006.1.38158 WP_003414006.1.38159 WP_003414006.1.38210 WP_003414006.1.38233 WP_003414006.1.38240 WP_003414006.1.38299 WP_003414006.1.38332 WP_003414006.1.38347 WP_003414006.1.38354 WP_003414006.1.38380 WP_003414006.1.38384 WP_003414006.1.38389 WP_003414006.1.38398 WP_003414006.1.38402 WP_003414006.1.38418 WP_003414006.1.38421 WP_003414006.1.38466 WP_003414006.1.38477 WP_003414006.1.38483 WP_003414006.1.3849 WP_003414006.1.385 WP_003414006.1.38530 WP_003414006.1.38535 WP_003414006.1.38594 WP_003414006.1.38601 WP_003414006.1.38611 WP_003414006.1.38638 WP_003414006.1.38639 WP_003414006.1.38646 WP_003414006.1.38648 WP_003414006.1.38654 WP_003414006.1.38659 WP_003414006.1.38660 WP_003414006.1.38666 WP_003414006.1.38671 WP_003414006.1.38672 WP_003414006.1.38677 WP_003414006.1.38750 WP_003414006.1.38772 WP_003414006.1.38812 WP_003414006.1.38821 WP_003414006.1.38844 WP_003414006.1.38863 WP_003414006.1.38873 WP_003414006.1.3889 WP_003414006.1.38894 WP_003414006.1.38909 WP_003414006.1.38939 WP_003414006.1.38974 WP_003414006.1.38975 WP_003414006.1.38991 WP_003414006.1.39025 WP_003414006.1.39070 WP_003414006.1.39072 WP_003414006.1.39095 WP_003414006.1.39106 WP_003414006.1.39165 WP_003414006.1.39174 WP_003414006.1.39176 WP_003414006.1.39178 WP_003414006.1.39190 WP_003414006.1.39201 WP_003414006.1.39207 WP_003414006.1.39211 WP_003414006.1.39236 WP_003414006.1.39239 WP_003414006.1.39252 WP_003414006.1.39288 WP_003414006.1.39295 WP_003414006.1.39306 WP_003414006.1.39359 WP_003414006.1.39364 WP_003414006.1.39400 WP_003414006.1.39447 WP_003414006.1.3945 WP_003414006.1.39450 WP_003414006.1.39455 WP_003414006.1.39521 WP_003414006.1.39560 WP_003414006.1.39592 WP_003414006.1.39593 WP_003414006.1.396 WP_003414006.1.3960 WP_003414006.1.39616 WP_003414006.1.39654 WP_003414006.1.39657 WP_003414006.1.39661 WP_003414006.1.39674 WP_003414006.1.39678 WP_003414006.1.3968 WP_003414006.1.39694 WP_003414006.1.3971 WP_003414006.1.39718 WP_003414006.1.39728 WP_003414006.1.39739 WP_003414006.1.39748 WP_003414006.1.39751 WP_003414006.1.39759 WP_003414006.1.39801 WP_003414006.1.39804 WP_003414006.1.39848 WP_003414006.1.39877 WP_003414006.1.39925 WP_003414006.1.3994 WP_003414006.1.39959 WP_003414006.1.3996 WP_003414006.1.39960 WP_003414006.1.3997 WP_003414006.1.39980 WP_003414006.1.40000 WP_003414006.1.40028 WP_003414006.1.40029 WP_003414006.1.4003 WP_003414006.1.40094 WP_003414006.1.40096 WP_003414006.1.40150 WP_003414006.1.40156 WP_003414006.1.40174 WP_003414006.1.40186 WP_003414006.1.40276 WP_003414006.1.40277 WP_003414006.1.40323 WP_003414006.1.40336 WP_003414006.1.40353 WP_003414006.1.4036 WP_003414006.1.40372 WP_003414006.1.40402 WP_003414006.1.40413 WP_003414006.1.40440 WP_003414006.1.40446 WP_003414006.1.40451 WP_003414006.1.40455 WP_003414006.1.40523 WP_003414006.1.40641 WP_003414006.1.40646 WP_003414006.1.40651 WP_003414006.1.40653 WP_003414006.1.4067 WP_003414006.1.40705 WP_003414006.1.40723 WP_003414006.1.40731 WP_003414006.1.40735 WP_003414006.1.40799 WP_003414006.1.40876 WP_003414006.1.40881 WP_003414006.1.40922 WP_003414006.1.40948 WP_003414006.1.4095 WP_003414006.1.40956 WP_003414006.1.40957 WP_003414006.1.4097 WP_003414006.1.410 WP_003414006.1.41000 WP_003414006.1.41055 WP_003414006.1.41108 WP_003414006.1.41123 WP_003414006.1.41177 WP_003414006.1.41202 WP_003414006.1.41219 WP_003414006.1.41231 WP_003414006.1.41249 WP_003414006.1.4127 WP_003414006.1.41296 WP_003414006.1.41355 WP_003414006.1.41376 WP_003414006.1.41430 WP_003414006.1.41447 WP_003414006.1.41469 WP_003414006.1.41504 WP_003414006.1.41553 WP_003414006.1.41564 WP_003414006.1.41583 WP_003414006.1.41616 WP_003414006.1.41632 WP_003414006.1.41635 WP_003414006.1.41636 WP_003414006.1.41648 WP_003414006.1.41660 WP_003414006.1.41685 WP_003414006.1.41695 WP_003414006.1.41704 WP_003414006.1.4171 WP_003414006.1.41719 WP_003414006.1.41744 WP_003414006.1.41774 WP_003414006.1.41791 WP_003414006.1.41803 WP_003414006.1.41820 WP_003414006.1.41828 WP_003414006.1.41829 WP_003414006.1.41860 WP_003414006.1.41912 WP_003414006.1.41921 WP_003414006.1.41933 WP_003414006.1.41944 WP_003414006.1.42043 WP_003414006.1.42075 WP_003414006.1.42078 WP_003414006.1.42094 WP_003414006.1.42112 WP_003414006.1.4212 WP_003414006.1.42122 WP_003414006.1.42134 WP_003414006.1.42183 WP_003414006.1.42188 WP_003414006.1.42201 WP_003414006.1.42202 WP_003414006.1.42208 WP_003414006.1.42247 WP_003414006.1.42255 WP_003414006.1.42273 WP_003414006.1.42278 WP_003414006.1.42304 WP_003414006.1.42309 WP_003414006.1.42370 WP_003414006.1.42385 WP_003414006.1.42400 WP_003414006.1.42409 WP_003414006.1.42414 WP_003414006.1.42417 WP_003414006.1.42430 WP_003414006.1.42465 WP_003414006.1.42467 WP_003414006.1.42473 WP_003414006.1.42474 WP_003414006.1.4248 WP_003414006.1.42494 WP_003414006.1.42519 WP_003414006.1.42524 WP_003414006.1.42534 WP_003414006.1.42562 WP_003414006.1.42568 WP_003414006.1.42570 WP_003414006.1.42618 WP_003414006.1.42660 WP_003414006.1.42695 WP_003414006.1.42704 WP_003414006.1.42705 WP_003414006.1.42722 WP_003414006.1.42777 WP_003414006.1.42782 WP_003414006.1.42835 WP_003414006.1.42839 WP_003414006.1.42842 WP_003414006.1.42905 WP_003414006.1.42916 WP_003414006.1.42930 WP_003414006.1.42971 WP_003414006.1.43005 WP_003414006.1.43009 WP_003414006.1.43053 WP_003414006.1.43082 WP_003414006.1.43087 WP_003414006.1.43098 WP_003414006.1.43208 WP_003414006.1.43236 WP_003414006.1.43246 WP_003414006.1.43266 WP_003414006.1.43269 WP_003414006.1.43273 WP_003414006.1.43296 WP_003414006.1.43306 WP_003414006.1.4335 WP_003414006.1.43368 WP_003414006.1.43395 WP_003414006.1.43457 WP_003414006.1.43462 WP_003414006.1.43475 WP_003414006.1.43478 WP_003414006.1.43484 WP_003414006.1.43557 WP_003414006.1.43578 WP_003414006.1.43588 WP_003414006.1.43643 WP_003414006.1.43664 WP_003414006.1.43684 WP_003414006.1.43686 WP_003414006.1.43706 WP_003414006.1.43716 WP_003414006.1.4377 WP_003414006.1.43781 WP_003414006.1.43794 WP_003414006.1.43815 WP_003414006.1.43846 WP_003414006.1.43861 WP_003414006.1.43863 WP_003414006.1.43866 WP_003414006.1.43872 WP_003414006.1.43885 WP_003414006.1.43897 WP_003414006.1.4390 WP_003414006.1.43902 WP_003414006.1.43921 WP_003414006.1.43936 WP_003414006.1.43937 WP_003414006.1.43960 WP_003414006.1.43965 WP_003414006.1.4399 WP_003414006.1.43993 WP_003414006.1.43996 WP_003414006.1.44 WP_003414006.1.44001 WP_003414006.1.44008 WP_003414006.1.44016 WP_003414006.1.44033 WP_003414006.1.44037 WP_003414006.1.44041 WP_003414006.1.44070 WP_003414006.1.44071 WP_003414006.1.44076 WP_003414006.1.44104 WP_003414006.1.44111 WP_003414006.1.44124 WP_003414006.1.44169 WP_003414006.1.44219 WP_003414006.1.44237 WP_003414006.1.44277 WP_003414006.1.44279 WP_003414006.1.44336 WP_003414006.1.44355 WP_003414006.1.44358 WP_003414006.1.4438 WP_003414006.1.44390 WP_003414006.1.44392 WP_003414006.1.4441 WP_003414006.1.44415 WP_003414006.1.44464 WP_003414006.1.44466 WP_003414006.1.44489 WP_003414006.1.44492 WP_003414006.1.44494 WP_003414006.1.44500 WP_003414006.1.44519 WP_003414006.1.44526 WP_003414006.1.44532 WP_003414006.1.44534 WP_003414006.1.44562 WP_003414006.1.44589 WP_003414006.1.44597 WP_003414006.1.44600 WP_003414006.1.44602 WP_003414006.1.44615 WP_003414006.1.4464 WP_003414006.1.44651 WP_003414006.1.44659 WP_003414006.1.44665 WP_003414006.1.44694 WP_003414006.1.44700 WP_003414006.1.44713 WP_003414006.1.44735 WP_003414006.1.44740 WP_003414006.1.44757 WP_003414006.1.4476 WP_003414006.1.44761 WP_003414006.1.44767 WP_003414006.1.44776 WP_003414006.1.44779 WP_003414006.1.44786 WP_003414006.1.44808 WP_003414006.1.44864 WP_003414006.1.44901 WP_003414006.1.44908 WP_003414006.1.44913 WP_003414006.1.4492 WP_003414006.1.44939 WP_003414006.1.44979 WP_003414006.1.44981 WP_003414006.1.45002 WP_003414006.1.45011 WP_003414006.1.45066 WP_003414006.1.45081 WP_003414006.1.45113 WP_003414006.1.45129 WP_003414006.1.45135 WP_003414006.1.45147 WP_003414006.1.45168 WP_003414006.1.4517 WP_003414006.1.45181 WP_003414006.1.45185 WP_003414006.1.45192 WP_003414006.1.45200 WP_003414006.1.45205 WP_003414006.1.45211 WP_003414006.1.45249 WP_003414006.1.4526 WP_003414006.1.45286 WP_003414006.1.45326 WP_003414006.1.45347 WP_003414006.1.45374 WP_003414006.1.45390 WP_003414006.1.454 WP_003414006.1.45407 WP_003414006.1.45451 WP_003414006.1.45453 WP_003414006.1.45460 WP_003414006.1.45463 WP_003414006.1.45470 WP_003414006.1.45474 WP_003414006.1.45491 WP_003414006.1.45510 WP_003414006.1.45563 WP_003414006.1.45584 WP_003414006.1.45590 WP_003414006.1.45626 WP_003414006.1.45631 WP_003414006.1.45666 WP_003414006.1.45697 WP_003414006.1.4571 WP_003414006.1.45731 WP_003414006.1.45743 WP_003414006.1.45765 WP_003414006.1.45776 WP_003414006.1.45783 WP_003414006.1.45805 WP_003414006.1.45815 WP_003414006.1.45849 WP_003414006.1.45867 WP_003414006.1.45884 WP_003414006.1.45923 WP_003414006.1.45926 WP_003414006.1.45963 WP_003414006.1.45992 WP_003414006.1.46025 WP_003414006.1.46083 WP_003414006.1.46090 WP_003414006.1.46092 WP_003414006.1.46100 WP_003414006.1.46101 WP_003414006.1.46103 WP_003414006.1.46107 WP_003414006.1.46127 WP_003414006.1.46128 WP_003414006.1.46129 WP_003414006.1.46141 WP_003414006.1.46150 WP_003414006.1.46201 WP_003414006.1.46226 WP_003414006.1.4624 WP_003414006.1.46253 WP_003414006.1.46268 WP_003414006.1.46285 WP_003414006.1.46300 WP_003414006.1.46313 WP_003414006.1.46336 WP_003414006.1.46365 WP_003414006.1.46370 WP_003414006.1.46381 WP_003414006.1.46402 WP_003414006.1.46411 WP_003414006.1.4644 WP_003414006.1.46442 WP_003414006.1.46453 WP_003414006.1.46478 WP_003414006.1.46492 WP_003414006.1.46521 WP_003414006.1.4653 WP_003414006.1.46532 WP_003414006.1.46539 WP_003414006.1.46568 WP_003414006.1.46585 WP_003414006.1.46609 WP_003414006.1.46613 WP_003414006.1.46625 WP_003414006.1.46642 WP_003414006.1.46647 WP_003414006.1.46724 WP_003414006.1.46758 WP_003414006.1.46773 WP_003414006.1.46777 WP_003414006.1.46786 WP_003414006.1.46792 WP_003414006.1.46847 WP_003414006.1.46851 WP_003414006.1.46897 WP_003414006.1.46936 WP_003414006.1.46980 WP_003414006.1.47011 WP_003414006.1.47012 WP_003414006.1.47066 WP_003414006.1.47077 WP_003414006.1.47083 WP_003414006.1.47106 WP_003414006.1.47142 WP_003414006.1.47147 WP_003414006.1.47166 WP_003414006.1.47178 WP_003414006.1.47179 WP_003414006.1.47194 WP_003414006.1.47207 WP_003414006.1.47210 WP_003414006.1.47261 WP_003414006.1.47262 WP_003414006.1.47402 WP_003414006.1.47423 WP_003414006.1.47467 WP_003414006.1.47502 WP_003414006.1.4751 WP_003414006.1.47511 WP_003414006.1.47537 WP_003414006.1.47540 WP_003414006.1.47568 WP_003414006.1.47572 WP_003414006.1.47588 WP_003414006.1.47636 WP_003414006.1.4764 WP_003414006.1.47653 WP_003414006.1.47679 WP_003414006.1.47681 WP_003414006.1.47690 WP_003414006.1.4771 WP_003414006.1.47717 WP_003414006.1.47743 WP_003414006.1.47773 WP_003414006.1.47776 WP_003414006.1.47780 WP_003414006.1.47805 WP_003414006.1.47832 WP_003414006.1.47847 WP_003414006.1.47858 WP_003414006.1.47861 WP_003414006.1.47868 WP_003414006.1.47893 WP_003414006.1.47899 WP_003414006.1.479 WP_003414006.1.47912 WP_003414006.1.47913 WP_003414006.1.47926 WP_003414006.1.47943 WP_003414006.1.47944 WP_003414006.1.47959 WP_003414006.1.47974 WP_003414006.1.47993 WP_003414006.1.48004 WP_003414006.1.48039 WP_003414006.1.48050 WP_003414006.1.48084 WP_003414006.1.48097 WP_003414006.1.48101 WP_003414006.1.48109 WP_003414006.1.4813 WP_003414006.1.48130 WP_003414006.1.48135 WP_003414006.1.48143 WP_003414006.1.48152 WP_003414006.1.48155 WP_003414006.1.48170 WP_003414006.1.48173 WP_003414006.1.48177 WP_003414006.1.48185 WP_003414006.1.48219 WP_003414006.1.4823 WP_003414006.1.48240 WP_003414006.1.48256 WP_003414006.1.48264 WP_003414006.1.48287 WP_003414006.1.48330 WP_003414006.1.48333 WP_003414006.1.48348 WP_003414006.1.48354 WP_003414006.1.48372 WP_003414006.1.48383 WP_003414006.1.48388 WP_003414006.1.48419 WP_003414006.1.48423 WP_003414006.1.48443 WP_003414006.1.48450 WP_003414006.1.48462 WP_003414006.1.48543 WP_003414006.1.48550 WP_003414006.1.48605 WP_003414006.1.4863 WP_003414006.1.48648 WP_003414006.1.48658 WP_003414006.1.48666 WP_003414006.1.48687 WP_003414006.1.48779 WP_003414006.1.4878 WP_003414006.1.48798 WP_003414006.1.48802 WP_003414006.1.48826 WP_003414006.1.48831 WP_003414006.1.48843 WP_003414006.1.48857 WP_003414006.1.4890 WP_003414006.1.48946 WP_003414006.1.48979 WP_003414006.1.49017 WP_003414006.1.49048 WP_003414006.1.49059 WP_003414006.1.4906 WP_003414006.1.4907 WP_003414006.1.49103 WP_003414006.1.49110 WP_003414006.1.49111 WP_003414006.1.49112 WP_003414006.1.4919 WP_003414006.1.49251 WP_003414006.1.49263 WP_003414006.1.49291 WP_003414006.1.49296 WP_003414006.1.49335 WP_003414006.1.49337 WP_003414006.1.49419 WP_003414006.1.49426 WP_003414006.1.49437 WP_003414006.1.49439 WP_003414006.1.49474 WP_003414006.1.49506 WP_003414006.1.49523 WP_003414006.1.49526 WP_003414006.1.49532 WP_003414006.1.49588 WP_003414006.1.4959 WP_003414006.1.49678 WP_003414006.1.49687 WP_003414006.1.49699 WP_003414006.1.49709 WP_003414006.1.4971 WP_003414006.1.4972 WP_003414006.1.49736 WP_003414006.1.49746 WP_003414006.1.49764 WP_003414006.1.49773 WP_003414006.1.49796 WP_003414006.1.49814 WP_003414006.1.49815 WP_003414006.1.49816 WP_003414006.1.49839 WP_003414006.1.49857 WP_003414006.1.49878 WP_003414006.1.49880 WP_003414006.1.49944 WP_003414006.1.4999 WP_003414006.1.49990 WP_003414006.1.50068 WP_003414006.1.50077 WP_003414006.1.5008 WP_003414006.1.50081 WP_003414006.1.50122 WP_003414006.1.50126 WP_003414006.1.50149 WP_003414006.1.50162 WP_003414006.1.5018 WP_003414006.1.50194 WP_003414006.1.50218 WP_003414006.1.50235 WP_003414006.1.50249 WP_003414006.1.50265 WP_003414006.1.50271 WP_003414006.1.50324 WP_003414006.1.50347 WP_003414006.1.50372 WP_003414006.1.50398 WP_003414006.1.50407 WP_003414006.1.50444 WP_003414006.1.50466 WP_003414006.1.50472 WP_003414006.1.5048 WP_003414006.1.50498 WP_003414006.1.5050 WP_003414006.1.50540 WP_003414006.1.50554 WP_003414006.1.50557 WP_003414006.1.50601 WP_003414006.1.50632 WP_003414006.1.50633 WP_003414006.1.50655 WP_003414006.1.50659 WP_003414006.1.50683 WP_003414006.1.50689 WP_003414006.1.50692 WP_003414006.1.50714 WP_003414006.1.50729 WP_003414006.1.50756 WP_003414006.1.50784 WP_003414006.1.50794 WP_003414006.1.50841 WP_003414006.1.50860 WP_003414006.1.50868 WP_003414006.1.50877 WP_003414006.1.5096 WP_003414006.1.50981 WP_003414006.1.50987 WP_003414006.1.51003 WP_003414006.1.51009 WP_003414006.1.51037 WP_003414006.1.51074 WP_003414006.1.51082 WP_003414006.1.51101 WP_003414006.1.51116 WP_003414006.1.51149 WP_003414006.1.51156 WP_003414006.1.51157 WP_003414006.1.51232 WP_003414006.1.51239 WP_003414006.1.51247 WP_003414006.1.51266 WP_003414006.1.51279 WP_003414006.1.51291 WP_003414006.1.51294 WP_003414006.1.51301 WP_003414006.1.51329 WP_003414006.1.51391 WP_003414006.1.51422 WP_003414006.1.51445 WP_003414006.1.51455 WP_003414006.1.51466 WP_003414006.1.51468 WP_003414006.1.51478 WP_003414006.1.51497 WP_003414006.1.51520 WP_003414006.1.51593 WP_003414006.1.51628 WP_003414006.1.5164 WP_003414006.1.51647 WP_003414006.1.51660 WP_003414006.1.51696 WP_003414006.1.51721 WP_003414006.1.51788 WP_003414006.1.51795 WP_003414006.1.51801 WP_003414006.1.51817 WP_003414006.1.51819 WP_003414006.1.51854 WP_003414006.1.51923 WP_003414006.1.51942 WP_003414006.1.51948 WP_003414006.1.51963 WP_003414006.1.51969 WP_003414006.1.52000 WP_003414006.1.52001 WP_003414006.1.52003 WP_003414006.1.52006 WP_003414006.1.52036 WP_003414006.1.52038 WP_003414006.1.52046 WP_003414006.1.52059 WP_003414006.1.52069 WP_003414006.1.52082 WP_003414006.1.52102 WP_003414006.1.52166 WP_003414006.1.52168 WP_003414006.1.52173 WP_003414006.1.52178 WP_003414006.1.52206 WP_003414006.1.52216 WP_003414006.1.52238 WP_003414006.1.52241 WP_003414006.1.52280 WP_003414006.1.52314 WP_003414006.1.52385 WP_003414006.1.52390 WP_003414006.1.524 WP_003414006.1.52460 WP_003414006.1.52485 WP_003414006.1.52486 WP_003414006.1.52504 WP_003414006.1.52522 WP_003414006.1.52531 WP_003414006.1.52533 WP_003414006.1.52545 WP_003414006.1.52553 WP_003414006.1.52563 WP_003414006.1.52564 WP_003414006.1.52574 WP_003414006.1.52641 WP_003414006.1.52673 WP_003414006.1.52674 WP_003414006.1.52708 WP_003414006.1.52713 WP_003414006.1.52761 WP_003414006.1.52778 WP_003414006.1.52791 WP_003414006.1.52797 WP_003414006.1.52818 WP_003414006.1.52872 WP_003414006.1.52873 WP_003414006.1.52891 WP_003414006.1.52892 WP_003414006.1.52909 WP_003414006.1.52970 WP_003414006.1.52998 WP_003414006.1.53053 WP_003414006.1.53056 WP_003414006.1.5306 WP_003414006.1.53088 WP_003414006.1.5309 WP_003414006.1.531 WP_003414006.1.53117 WP_003414006.1.53118 WP_003414006.1.53142 WP_003414006.1.53143 WP_003414006.1.53157 WP_003414006.1.53167 WP_003414006.1.53200 WP_003414006.1.53204 WP_003414006.1.53213 WP_003414006.1.53217 WP_003414006.1.53226 WP_003414006.1.53229 WP_003414006.1.53230 WP_003414006.1.53237 WP_003414006.1.53254 WP_003414006.1.53257 WP_003414006.1.5327 WP_003414006.1.53276 WP_003414006.1.53278 WP_003414006.1.533 WP_003414006.1.53302 WP_003414006.1.53306 WP_003414006.1.5334 WP_003414006.1.5335 WP_003414006.1.53353 WP_003414006.1.53381 WP_003414006.1.53413 WP_003414006.1.53458 WP_003414006.1.53460 WP_003414006.1.53480 WP_003414006.1.53517 WP_003414006.1.53522 WP_003414006.1.53525 WP_003414006.1.53526 WP_003414006.1.53553 WP_003414006.1.53606 WP_003414006.1.53628 WP_003414006.1.53643 WP_003414006.1.53667 WP_003414006.1.53679 WP_003414006.1.53715 WP_003414006.1.53730 WP_003414006.1.53742 WP_003414006.1.53743 WP_003414006.1.53754 WP_003414006.1.53775 WP_003414006.1.53787 WP_003414006.1.53803 WP_003414006.1.53818 WP_003414006.1.53853 WP_003414006.1.53865 WP_003414006.1.53888 WP_003414006.1.53900 WP_003414006.1.53912 WP_003414006.1.53914 WP_003414006.1.53952 WP_003414006.1.5398 WP_003414006.1.5408 WP_003414006.1.54089 WP_003414006.1.54093 WP_003414006.1.54099 WP_003414006.1.54112 WP_003414006.1.54125 WP_003414006.1.54141 WP_003414006.1.54162 WP_003414006.1.54179 WP_003414006.1.54206 WP_003414006.1.54218 WP_003414006.1.54225 WP_003414006.1.54227 WP_003414006.1.54232 WP_003414006.1.54241 WP_003414006.1.54245 WP_003414006.1.54247 WP_003414006.1.54260 WP_003414006.1.54275 WP_003414006.1.54280 WP_003414006.1.5429 WP_003414006.1.54294 WP_003414006.1.54314 WP_003414006.1.54347 WP_003414006.1.54351 WP_003414006.1.54370 WP_003414006.1.54428 WP_003414006.1.54449 WP_003414006.1.54494 WP_003414006.1.54502 WP_003414006.1.54514 WP_003414006.1.54519 WP_003414006.1.5452 WP_003414006.1.54531 WP_003414006.1.54537 WP_003414006.1.54553 WP_003414006.1.54555 WP_003414006.1.54575 WP_003414006.1.54633 WP_003414006.1.54686 WP_003414006.1.54687 WP_003414006.1.54705 WP_003414006.1.54730 WP_003414006.1.54732 WP_003414006.1.5475 WP_003414006.1.54797 WP_003414006.1.54807 WP_003414006.1.54836 WP_003414006.1.54838 WP_003414006.1.54860 WP_003414006.1.54888 WP_003414006.1.54897 WP_003414006.1.54905 WP_003414006.1.54909 WP_003414006.1.54937 WP_003414006.1.54939 WP_003414006.1.54944 WP_003414006.1.54945 WP_003414006.1.54953 WP_003414006.1.54964 WP_003414006.1.55015 WP_003414006.1.55022 WP_003414006.1.55023 WP_003414006.1.55051 WP_003414006.1.55072 WP_003414006.1.55088 WP_003414006.1.55106 WP_003414006.1.55126 WP_003414006.1.55128 WP_003414006.1.55140 WP_003414006.1.55150 WP_003414006.1.55210 WP_003414006.1.55227 WP_003414006.1.55248 WP_003414006.1.55257 WP_003414006.1.55258 WP_003414006.1.55267 WP_003414006.1.55279 WP_003414006.1.55307 WP_003414006.1.55326 WP_003414006.1.55328 WP_003414006.1.5533 WP_003414006.1.55345 WP_003414006.1.55396 WP_003414006.1.55398 WP_003414006.1.55441 WP_003414006.1.55459 WP_003414006.1.55501 WP_003414006.1.55578 WP_003414006.1.55626 WP_003414006.1.55641 WP_003414006.1.5569 WP_003414006.1.55723 WP_003414006.1.55735 WP_003414006.1.5574 WP_003414006.1.55772 WP_003414006.1.55802 WP_003414006.1.55819 WP_003414006.1.55821 WP_003414006.1.5583 WP_003414006.1.55849 WP_003414006.1.55856 WP_003414006.1.55860 WP_003414006.1.55882 WP_003414006.1.55883 WP_003414006.1.55894 WP_003414006.1.55902 WP_003414006.1.55908 WP_003414006.1.55909 WP_003414006.1.5591 WP_003414006.1.55961 WP_003414006.1.55977 WP_003414006.1.55983 WP_003414006.1.56028 WP_003414006.1.56057 WP_003414006.1.56060 WP_003414006.1.56107 WP_003414006.1.56132 WP_003414006.1.56163 WP_003414006.1.56167 WP_003414006.1.56178 WP_003414006.1.56287 WP_003414006.1.56292 WP_003414006.1.56327 WP_003414006.1.56341 WP_003414006.1.56359 WP_003414006.1.56365 WP_003414006.1.56394 WP_003414006.1.56443 WP_003414006.1.56473 WP_003414006.1.56478 WP_003414006.1.56500 WP_003414006.1.56517 WP_003414006.1.56534 WP_003414006.1.5656 WP_003414006.1.56577 WP_003414006.1.56593 WP_003414006.1.56625 WP_003414006.1.56637 WP_003414006.1.56670 WP_003414006.1.56697 WP_003414006.1.567 WP_003414006.1.56701 WP_003414006.1.56709 WP_003414006.1.56729 WP_003414006.1.56743 WP_003414006.1.56755 WP_003414006.1.56764 WP_003414006.1.56769 WP_003414006.1.56770 WP_003414006.1.56795 WP_003414006.1.5681 WP_003414006.1.56827 WP_003414006.1.56839 WP_003414006.1.56863 WP_003414006.1.56868 WP_003414006.1.56869 WP_003414006.1.56915 WP_003414006.1.56926 WP_003414006.1.56961 WP_003414006.1.56971 WP_003414006.1.56972 WP_003414006.1.57023 WP_003414006.1.57035 WP_003414006.1.57077 WP_003414006.1.57087 WP_003414006.1.57094 WP_003414006.1.57134 WP_003414006.1.57151 WP_003414006.1.57169 WP_003414006.1.57208 WP_003414006.1.57230 WP_003414006.1.5724 WP_003414006.1.5727 WP_003414006.1.57273 WP_003414006.1.573 WP_003414006.1.57314 WP_003414006.1.57326 WP_003414006.1.57328 WP_003414006.1.57331 WP_003414006.1.57340 WP_003414006.1.57351 WP_003414006.1.57352 WP_003414006.1.57380 WP_003414006.1.57430 WP_003414006.1.5744 WP_003414006.1.57440 WP_003414006.1.5745 WP_003414006.1.57461 WP_003414006.1.57469 WP_003414006.1.57489 WP_003414006.1.575 WP_003414006.1.57509 WP_003414006.1.57519 WP_003414006.1.57525 WP_003414006.1.57551 WP_003414006.1.57596 WP_003414006.1.57604 WP_003414006.1.57616 WP_003414006.1.57617 WP_003414006.1.57619 WP_003414006.1.57627 WP_003414006.1.57642 WP_003414006.1.57658 WP_003414006.1.57667 WP_003414006.1.57675 WP_003414006.1.57689 WP_003414006.1.57708 WP_003414006.1.57821 WP_003414006.1.57825 WP_003414006.1.57843 WP_003414006.1.57906 WP_003414006.1.57924 WP_003414006.1.57926 WP_003414006.1.57930 WP_003414006.1.57957 WP_003414006.1.57960 WP_003414006.1.57964 WP_003414006.1.57991 WP_003414006.1.58000 WP_003414006.1.58086 WP_003414006.1.58101 WP_003414006.1.58103 WP_003414006.1.58108 WP_003414006.1.5811 WP_003414006.1.58121 WP_003414006.1.58145 WP_003414006.1.58164 WP_003414006.1.58174 WP_003414006.1.582 WP_003414006.1.58202 WP_003414006.1.58209 WP_003414006.1.5824 WP_003414006.1.58250 WP_003414006.1.58259 WP_003414006.1.58283 WP_003414006.1.58288 WP_003414006.1.5830 WP_003414006.1.58303 WP_003414006.1.58311 WP_003414006.1.58330 WP_003414006.1.58359 WP_003414006.1.58386 WP_003414006.1.58393 WP_003414006.1.58431 WP_003414006.1.5844 WP_003414006.1.58457 WP_003414006.1.58488 WP_003414006.1.58518 WP_003414006.1.58534 WP_003414006.1.58559 WP_003414006.1.58567 WP_003414006.1.58573 WP_003414006.1.58602 WP_003414006.1.58612 WP_003414006.1.58619 WP_003414006.1.58630 WP_003414006.1.5865 WP_003414006.1.58671 WP_003414006.1.58690 WP_003414006.1.58743 WP_003414006.1.58754 WP_003414006.1.5879 WP_003414006.1.5881 WP_003414006.1.58824 WP_003414006.1.58848 WP_003414006.1.58857 WP_003414006.1.58891 WP_003414006.1.58892 WP_003414006.1.5890 WP_003414006.1.58904 WP_003414006.1.58930 WP_003414006.1.58941 WP_003414006.1.58953 WP_003414006.1.58961 WP_003414006.1.5898 WP_003414006.1.59025 WP_003414006.1.59029 WP_003414006.1.59037 WP_003414006.1.59044 WP_003414006.1.59085 WP_003414006.1.59088 WP_003414006.1.59112 WP_003414006.1.59130 WP_003414006.1.5914 WP_003414006.1.59147 WP_003414006.1.59166 WP_003414006.1.59205 WP_003414006.1.59209 WP_003414006.1.59237 WP_003414006.1.59240 WP_003414006.1.59253 WP_003414006.1.59254 WP_003414006.1.59262 WP_003414006.1.59270 WP_003414006.1.5928 WP_003414006.1.59304 WP_003414006.1.59305 WP_003414006.1.59309 WP_003414006.1.59316 WP_003414006.1.59326 WP_003414006.1.59328 WP_003414006.1.59333 WP_003414006.1.59338 WP_003414006.1.59428 WP_003414006.1.59487 WP_003414006.1.59537 WP_003414006.1.59561 WP_003414006.1.59677 WP_003414006.1.59722 WP_003414006.1.59727 WP_003414006.1.59732 WP_003414006.1.59738 WP_003414006.1.59750 WP_003414006.1.59757 WP_003414006.1.59761 WP_003414006.1.59808 WP_003414006.1.59856 WP_003414006.1.59860 WP_003414006.1.59861 WP_003414006.1.5987 WP_003414006.1.59878 WP_003414006.1.59888 WP_003414006.1.59952 WP_003414006.1.5996 WP_003414006.1.59961 WP_003414006.1.59974 WP_003414006.1.6000 WP_003414006.1.60007 WP_003414006.1.60016 WP_003414006.1.6003 WP_003414006.1.60047 WP_003414006.1.6007 WP_003414006.1.60121 WP_003414006.1.60125 WP_003414006.1.60135 WP_003414006.1.60139 WP_003414006.1.60152 WP_003414006.1.60171 WP_003414006.1.60197 WP_003414006.1.6020 WP_003414006.1.60205 WP_003414006.1.60207 WP_003414006.1.60215 WP_003414006.1.60217 WP_003414006.1.60267 WP_003414006.1.60288 WP_003414006.1.60291 WP_003414006.1.60301 WP_003414006.1.60305 WP_003414006.1.60312 WP_003414006.1.60313 WP_003414006.1.60314 WP_003414006.1.60367 WP_003414006.1.60376 WP_003414006.1.60403 WP_003414006.1.60413 WP_003414006.1.60421 WP_003414006.1.60451 WP_003414006.1.60460 WP_003414006.1.60479 WP_003414006.1.60487 WP_003414006.1.60512 WP_003414006.1.60573 WP_003414006.1.60632 WP_003414006.1.60657 WP_003414006.1.60687 WP_003414006.1.60689 WP_003414006.1.60727 WP_003414006.1.60738 WP_003414006.1.60763 WP_003414006.1.6077 WP_003414006.1.60791 WP_003414006.1.60834 WP_003414006.1.60870 WP_003414006.1.60878 WP_003414006.1.60879 WP_003414006.1.60913 WP_003414006.1.60978 WP_003414006.1.61000 WP_003414006.1.61012 WP_003414006.1.61014 WP_003414006.1.61015 WP_003414006.1.61037 WP_003414006.1.61052 WP_003414006.1.61065 WP_003414006.1.61100 WP_003414006.1.61101 WP_003414006.1.61138 WP_003414006.1.61142 WP_003414006.1.61198 WP_003414006.1.61234 WP_003414006.1.61256 WP_003414006.1.61281 WP_003414006.1.61314 WP_003414006.1.61321 WP_003414006.1.61326 WP_003414006.1.61328 WP_003414006.1.61368 WP_003414006.1.61391 WP_003414006.1.61406 WP_003414006.1.61409 WP_003414006.1.61420 WP_003414006.1.61422 WP_003414006.1.61425 WP_003414006.1.61428 WP_003414006.1.61469 WP_003414006.1.61494 WP_003414006.1.61522 WP_003414006.1.61552 WP_003414006.1.61557 WP_003414006.1.61567 WP_003414006.1.61571 WP_003414006.1.61573 WP_003414006.1.61584 WP_003414006.1.61586 WP_003414006.1.6159 WP_003414006.1.61592 WP_003414006.1.6160 WP_003414006.1.61614 WP_003414006.1.6163 WP_003414006.1.61655 WP_003414006.1.61665 WP_003414006.1.61669 WP_003414006.1.61682 WP_003414006.1.61692 WP_003414006.1.61719 WP_003414006.1.61728 WP_003414006.1.61750 WP_003414006.1.61754 WP_003414006.1.61755 WP_003414006.1.61757 WP_003414006.1.61778 WP_003414006.1.6179 WP_003414006.1.61816 WP_003414006.1.61842 WP_003414006.1.61850 WP_003414006.1.61865 WP_003414006.1.61868 WP_003414006.1.61911 WP_003414006.1.61941 WP_003414006.1.61953 WP_003414006.1.61986 WP_003414006.1.61987 WP_003414006.1.61998 WP_003414006.1.62021 WP_003414006.1.62087 WP_003414006.1.62089 WP_003414006.1.62101 WP_003414006.1.62104 WP_003414006.1.6211 WP_003414006.1.62132 WP_003414006.1.62162 WP_003414006.1.62225 WP_003414006.1.62230 WP_003414006.1.62238 WP_003414006.1.62249 WP_003414006.1.62270 WP_003414006.1.62281 WP_003414006.1.62307 WP_003414006.1.6231 WP_003414006.1.62359 WP_003414006.1.62360 WP_003414006.1.62371 WP_003414006.1.62379 WP_003414006.1.62395 WP_003414006.1.62408 WP_003414006.1.62449 WP_003414006.1.62468 WP_003414006.1.6248 WP_003414006.1.62508 WP_003414006.1.62565 WP_003414006.1.62594 WP_003414006.1.62606 WP_003414006.1.62616 WP_003414006.1.62666 WP_003414006.1.62687 WP_003414006.1.62730 WP_003414006.1.62738 WP_003414006.1.62761 WP_003414006.1.62766 WP_003414006.1.62786 WP_003414006.1.62813 WP_003414006.1.62839 WP_003414006.1.62841 WP_003414006.1.62909 WP_003414006.1.62936 WP_003414006.1.6294 WP_003414006.1.6295 WP_003414006.1.62962 WP_003414006.1.63007 WP_003414006.1.63019 WP_003414006.1.63032 WP_003414006.1.63037 WP_003414006.1.63064 WP_003414006.1.63066 WP_003414006.1.63072 WP_003414006.1.6308 WP_003414006.1.63081 WP_003414006.1.63096 WP_003414006.1.63106 WP_003414006.1.6314 WP_003414006.1.63144 WP_003414006.1.63154 WP_003414006.1.63160 WP_003414006.1.63161 WP_003414006.1.63175 WP_003414006.1.63194 WP_003414006.1.6322 WP_003414006.1.63222 WP_003414006.1.6328 WP_003414006.1.63291 WP_003414006.1.63312 WP_003414006.1.63317 WP_003414006.1.63331 WP_003414006.1.63373 WP_003414006.1.63384 WP_003414006.1.63403 WP_003414006.1.63424 WP_003414006.1.63428 WP_003414006.1.6345 WP_003414006.1.63464 WP_003414006.1.63483 WP_003414006.1.63502 WP_003414006.1.63504 WP_003414006.1.63522 WP_003414006.1.63530 WP_003414006.1.63564 WP_003414006.1.63567 WP_003414006.1.63596 WP_003414006.1.63600 WP_003414006.1.63623 WP_003414006.1.63624 WP_003414006.1.63625 WP_003414006.1.63627 WP_003414006.1.63654 WP_003414006.1.63662 WP_003414006.1.63711 WP_003414006.1.63734 WP_003414006.1.63807 WP_003414006.1.63819 WP_003414006.1.63844 WP_003414006.1.63888 WP_003414006.1.63913 WP_003414006.1.63915 WP_003414006.1.63918 WP_003414006.1.63961 WP_003414006.1.63970 WP_003414006.1.64000 WP_003414006.1.64027 WP_003414006.1.64058 WP_003414006.1.64065 WP_003414006.1.6407 WP_003414006.1.64082 WP_003414006.1.64091 WP_003414006.1.64102 WP_003414006.1.64104 WP_003414006.1.64119 WP_003414006.1.64169 WP_003414006.1.64219 WP_003414006.1.6422 WP_003414006.1.64222 WP_003414006.1.64228 WP_003414006.1.64235 WP_003414006.1.64249 WP_003414006.1.6427 WP_003414006.1.64278 WP_003414006.1.64287 WP_003414006.1.64414 WP_003414006.1.64419 WP_003414006.1.6443 WP_003414006.1.64463 WP_003414006.1.64480 WP_003414006.1.64497 WP_003414006.1.64506 WP_003414006.1.64511 WP_003414006.1.64513 WP_003414006.1.64514 WP_003414006.1.64515 WP_003414006.1.64522 WP_003414006.1.64526 WP_003414006.1.64543 WP_003414006.1.6456 WP_003414006.1.64567 WP_003414006.1.64588 WP_003414006.1.64589 WP_003414006.1.64594 WP_003414006.1.64595 WP_003414006.1.64608 WP_003414006.1.64619 WP_003414006.1.64629 WP_003414006.1.6464 WP_003414006.1.64664 WP_003414006.1.64669 WP_003414006.1.64672 WP_003414006.1.64680 WP_003414006.1.64682 WP_003414006.1.64727 WP_003414006.1.64729 WP_003414006.1.64774 WP_003414006.1.64776 WP_003414006.1.64802 WP_003414006.1.64832 WP_003414006.1.6486 WP_003414006.1.64870 WP_003414006.1.64898 WP_003414006.1.64922 WP_003414006.1.64924 WP_003414006.1.6493 WP_003414006.1.64937 WP_003414006.1.64941 WP_003414006.1.64966 WP_003414006.1.64973 WP_003414006.1.65001 WP_003414006.1.65026 WP_003414006.1.65053 WP_003414006.1.65070 WP_003414006.1.65079 WP_003414006.1.65102 WP_003414006.1.65157 WP_003414006.1.65181 WP_003414006.1.65212 WP_003414006.1.65229 WP_003414006.1.6523 WP_003414006.1.65253 WP_003414006.1.65289 WP_003414006.1.65291 WP_003414006.1.65315 WP_003414006.1.65329 WP_003414006.1.65359 WP_003414006.1.6536 WP_003414006.1.65374 WP_003414006.1.65386 WP_003414006.1.65414 WP_003414006.1.65416 WP_003414006.1.65433 WP_003414006.1.65455 WP_003414006.1.65467 WP_003414006.1.65488 WP_003414006.1.65529 WP_003414006.1.65539 WP_003414006.1.65583 WP_003414006.1.65612 WP_003414006.1.65623 WP_003414006.1.65635 WP_003414006.1.65637 WP_003414006.1.65648 WP_003414006.1.65683 WP_003414006.1.65686 WP_003414006.1.65688 WP_003414006.1.65707 WP_003414006.1.65733 WP_003414006.1.65746 WP_003414006.1.65747 WP_003414006.1.65759 WP_003414006.1.65816 WP_003414006.1.65830 WP_003414006.1.65858 WP_003414006.1.65862 WP_003414006.1.65869 WP_003414006.1.65893 WP_003414006.1.65929 WP_003414006.1.65958 WP_003414006.1.65974 WP_003414006.1.66004 WP_003414006.1.66013 WP_003414006.1.6606 WP_003414006.1.66089 WP_003414006.1.66149 WP_003414006.1.66151 WP_003414006.1.66229 WP_003414006.1.66276 WP_003414006.1.66293 WP_003414006.1.66297 WP_003414006.1.66323 WP_003414006.1.66325 WP_003414006.1.6633 WP_003414006.1.66334 WP_003414006.1.66355 WP_003414006.1.66367 WP_003414006.1.66394 WP_003414006.1.66396 WP_003414006.1.66451 WP_003414006.1.66455 WP_003414006.1.66457 WP_003414006.1.66460 WP_003414006.1.66464 WP_003414006.1.66466 WP_003414006.1.66487 WP_003414006.1.66504 WP_003414006.1.66544 WP_003414006.1.66558 WP_003414006.1.66582 WP_003414006.1.66612 WP_003414006.1.66615 WP_003414006.1.66617 WP_003414006.1.66635 WP_003414006.1.66656 WP_003414006.1.66663 WP_003414006.1.66675 WP_003414006.1.66715 WP_003414006.1.66718 WP_003414006.1.66762 WP_003414006.1.66776 WP_003414006.1.66808 WP_003414006.1.66817 WP_003414006.1.66819 WP_003414006.1.66826 WP_003414006.1.66830 WP_003414006.1.66842 WP_003414006.1.66868 WP_003414006.1.66878 WP_003414006.1.66880 WP_003414006.1.66893 WP_003414006.1.66961 WP_003414006.1.67005 WP_003414006.1.6704 WP_003414006.1.67044 WP_003414006.1.67061 WP_003414006.1.67089 WP_003414006.1.67098 WP_003414006.1.67170 WP_003414006.1.67197 WP_003414006.1.67198 WP_003414006.1.6720 WP_003414006.1.67207 WP_003414006.1.67218 WP_003414006.1.67220 WP_003414006.1.67225 WP_003414006.1.67231 WP_003414006.1.6724 WP_003414006.1.67257 WP_003414006.1.67298 WP_003414006.1.67307 WP_003414006.1.67324 WP_003414006.1.67332 WP_003414006.1.67346 WP_003414006.1.67354 WP_003414006.1.67360 WP_003414006.1.67396 WP_003414006.1.67417 WP_003414006.1.67422 WP_003414006.1.67453 WP_003414006.1.67459 WP_003414006.1.6746 WP_003414006.1.67473 WP_003414006.1.67481 WP_003414006.1.67482 WP_003414006.1.67496 WP_003414006.1.67499 WP_003414006.1.67516 WP_003414006.1.67523 WP_003414006.1.67536 WP_003414006.1.67575 WP_003414006.1.67587 WP_003414006.1.67598 WP_003414006.1.67600 WP_003414006.1.67602 WP_003414006.1.67630 WP_003414006.1.67679 WP_003414006.1.67692 WP_003414006.1.67744 WP_003414006.1.6775 WP_003414006.1.67750 WP_003414006.1.6777 WP_003414006.1.67809 WP_003414006.1.67816 WP_003414006.1.67844 WP_003414006.1.67848 WP_003414006.1.67870 WP_003414006.1.67888 WP_003414006.1.67915 WP_003414006.1.67945 WP_003414006.1.67949 WP_003414006.1.67980 WP_003414006.1.67982 WP_003414006.1.68022 WP_003414006.1.68029 WP_003414006.1.68037 WP_003414006.1.68038 WP_003414006.1.68045 WP_003414006.1.68057 WP_003414006.1.68083 WP_003414006.1.68088 WP_003414006.1.68106 WP_003414006.1.68110 WP_003414006.1.68153 WP_003414006.1.68169 WP_003414006.1.68193 WP_003414006.1.68212 WP_003414006.1.68227 WP_003414006.1.68243 WP_003414006.1.6825 WP_003414006.1.68297 WP_003414006.1.68309 WP_003414006.1.68325 WP_003414006.1.68329 WP_003414006.1.68340 WP_003414006.1.68384 WP_003414006.1.68388 WP_003414006.1.68429 WP_003414006.1.6843 WP_003414006.1.68433 WP_003414006.1.68444 WP_003414006.1.68465 WP_003414006.1.68484 WP_003414006.1.68518 WP_003414006.1.68569 WP_003414006.1.68576 WP_003414006.1.68586 WP_003414006.1.68623 WP_003414006.1.68637 WP_003414006.1.68646 WP_003414006.1.68667 WP_003414006.1.68669 WP_003414006.1.68672 WP_003414006.1.68684 WP_003414006.1.68704 WP_003414006.1.68708 WP_003414006.1.6872 WP_003414006.1.68730 WP_003414006.1.68734 WP_003414006.1.68748 WP_003414006.1.68754 WP_003414006.1.6876 WP_003414006.1.68761 WP_003414006.1.68763 WP_003414006.1.68766 WP_003414006.1.68774 WP_003414006.1.68796 WP_003414006.1.68824 WP_003414006.1.68832 WP_003414006.1.68833 WP_003414006.1.68841 WP_003414006.1.68859 WP_003414006.1.68876 WP_003414006.1.68906 WP_003414006.1.68916 WP_003414006.1.68923 WP_003414006.1.68945 WP_003414006.1.6896 WP_003414006.1.68981 WP_003414006.1.68984 WP_003414006.1.68997 WP_003414006.1.69008 WP_003414006.1.69076 WP_003414006.1.69079 WP_003414006.1.6908 WP_003414006.1.69082 WP_003414006.1.69178 WP_003414006.1.69181 WP_003414006.1.69208 WP_003414006.1.69231 WP_003414006.1.69256 WP_003414006.1.69311 WP_003414006.1.69315 WP_003414006.1.69322 WP_003414006.1.69342 WP_003414006.1.6935 WP_003414006.1.6936 WP_003414006.1.69374 WP_003414006.1.69398 WP_003414006.1.69401 WP_003414006.1.69426 WP_003414006.1.69427 WP_003414006.1.69429 WP_003414006.1.6949 WP_003414006.1.6951 WP_003414006.1.69511 WP_003414006.1.69526 WP_003414006.1.69528 WP_003414006.1.69547 WP_003414006.1.69573 WP_003414006.1.69581 WP_003414006.1.6960 WP_003414006.1.69617 WP_003414006.1.69634 WP_003414006.1.69647 WP_003414006.1.69659 WP_003414006.1.69673 WP_003414006.1.69682 WP_003414006.1.69684 WP_003414006.1.69686 WP_003414006.1.69707 WP_003414006.1.69709 WP_003414006.1.69723 WP_003414006.1.69736 WP_003414006.1.69778 WP_003414006.1.69800 WP_003414006.1.69802 WP_003414006.1.69845 WP_003414006.1.69870 WP_003414006.1.69873 WP_003414006.1.69898 WP_003414006.1.69913 WP_003414006.1.69931 WP_003414006.1.69938 WP_003414006.1.69955 WP_003414006.1.69957 WP_003414006.1.69981 WP_003414006.1.69990 WP_003414006.1.70 WP_003414006.1.70000 WP_003414006.1.70017 WP_003414006.1.70032 WP_003414006.1.70055 WP_003414006.1.70062 WP_003414006.1.70072 WP_003414006.1.70131 WP_003414006.1.70132 WP_003414006.1.7022 WP_003414006.1.70227 WP_003414006.1.70255 WP_003414006.1.70271 WP_003414006.1.70274 WP_003414006.1.7029 WP_003414006.1.70325 WP_003414006.1.70328 WP_003414006.1.70356 WP_003414006.1.70364 WP_003414006.1.70368 WP_003414006.1.70369 WP_003414006.1.70418 WP_003414006.1.70422 WP_003414006.1.70435 WP_003414006.1.70444 WP_003414006.1.70463 WP_003414006.1.70471 WP_003414006.1.70480 WP_003414006.1.70494 WP_003414006.1.70498 WP_003414006.1.70505 WP_003414006.1.70525 WP_003414006.1.70573 WP_003414006.1.70577 WP_003414006.1.70610 WP_003414006.1.70615 WP_003414006.1.70618 WP_003414006.1.70622 WP_003414006.1.70626 WP_003414006.1.70668 WP_003414006.1.70699 WP_003414006.1.70729 WP_003414006.1.70757 WP_003414006.1.70782 WP_003414006.1.70796 WP_003414006.1.70834 WP_003414006.1.7084 WP_003414006.1.70840 WP_003414006.1.70864 WP_003414006.1.70871 WP_003414006.1.70915 WP_003414006.1.70958 WP_003414006.1.70964 WP_003414006.1.70976 WP_003414006.1.71015 WP_003414006.1.71026 WP_003414006.1.71063 WP_003414006.1.71076 WP_003414006.1.71083 WP_003414006.1.7111 WP_003414006.1.71118 WP_003414006.1.7113 WP_003414006.1.71187 WP_003414006.1.71191 WP_003414006.1.71255 WP_003414006.1.71258 WP_003414006.1.71259 WP_003414006.1.71289 WP_003414006.1.71326 WP_003414006.1.71329 WP_003414006.1.71331 WP_003414006.1.71344 WP_003414006.1.71390 WP_003414006.1.71440 WP_003414006.1.71457 WP_003414006.1.71464 WP_003414006.1.71490 WP_003414006.1.71492 WP_003414006.1.71509 WP_003414006.1.71516 WP_003414006.1.71517 WP_003414006.1.71532 WP_003414006.1.71545 WP_003414006.1.71546 WP_003414006.1.71604 WP_003414006.1.71621 WP_003414006.1.71630 WP_003414006.1.71638 WP_003414006.1.71654 WP_003414006.1.71664 WP_003414006.1.71665 WP_003414006.1.71683 WP_003414006.1.71701 WP_003414006.1.71718 WP_003414006.1.71731 WP_003414006.1.71778 WP_003414006.1.71781 WP_003414006.1.71803 WP_003414006.1.71820 WP_003414006.1.71847 WP_003414006.1.7185 WP_003414006.1.71851 WP_003414006.1.71871 WP_003414006.1.71909 WP_003414006.1.71957 WP_003414006.1.71970 WP_003414006.1.72047 WP_003414006.1.72061 WP_003414006.1.72062 WP_003414006.1.72072 WP_003414006.1.72111 WP_003414006.1.72122 WP_003414006.1.72128 WP_003414006.1.72143 WP_003414006.1.7216 WP_003414006.1.72168 WP_003414006.1.72179 WP_003414006.1.72209 WP_003414006.1.72218 WP_003414006.1.72219 WP_003414006.1.72227 WP_003414006.1.7224 WP_003414006.1.72268 WP_003414006.1.72332 WP_003414006.1.72380 WP_003414006.1.72401 WP_003414006.1.72405 WP_003414006.1.72420 WP_003414006.1.72441 WP_003414006.1.72451 WP_003414006.1.72452 WP_003414006.1.72457 WP_003414006.1.72459 WP_003414006.1.72460 WP_003414006.1.72466 WP_003414006.1.72487 WP_003414006.1.72488 WP_003414006.1.72492 WP_003414006.1.72506 WP_003414006.1.72543 WP_003414006.1.7256 WP_003414006.1.72576 WP_003414006.1.72578 WP_003414006.1.72585 WP_003414006.1.72591 WP_003414006.1.72592 WP_003414006.1.72640 WP_003414006.1.7266 WP_003414006.1.72661 WP_003414006.1.72739 WP_003414006.1.72744 WP_003414006.1.72755 WP_003414006.1.72759 WP_003414006.1.72784 WP_003414006.1.72792 WP_003414006.1.72826 WP_003414006.1.72831 WP_003414006.1.72852 WP_003414006.1.72853 WP_003414006.1.72879 WP_003414006.1.72880 WP_003414006.1.72938 WP_003414006.1.72954 WP_003414006.1.72957 WP_003414006.1.72959 WP_003414006.1.7298 WP_003414006.1.72982 WP_003414006.1.72988 WP_003414006.1.72993 WP_003414006.1.73006 WP_003414006.1.73013 WP_003414006.1.73025 WP_003414006.1.73028 WP_003414006.1.73042 WP_003414006.1.73045 WP_003414006.1.73092 WP_003414006.1.73118 WP_003414006.1.7312 WP_003414006.1.73127 WP_003414006.1.73134 WP_003414006.1.73150 WP_003414006.1.73154 WP_003414006.1.73163 WP_003414006.1.73182 WP_003414006.1.73205 WP_003414006.1.7321 WP_003414006.1.73310 WP_003414006.1.73365 WP_003414006.1.73391 WP_003414006.1.73404 WP_003414006.1.73424 WP_003414006.1.73436 WP_003414006.1.73445 WP_003414006.1.73453 WP_003414006.1.73465 WP_003414006.1.73466 WP_003414006.1.73470 WP_003414006.1.73471 WP_003414006.1.73478 WP_003414006.1.73482 WP_003414006.1.73507 WP_003414006.1.73532 WP_003414006.1.73550 WP_003414006.1.73564 WP_003414006.1.73623 WP_003414006.1.73629 WP_003414006.1.73644 WP_003414006.1.7366 WP_003414006.1.73661 WP_003414006.1.7368 WP_003414006.1.73688 WP_003414006.1.73723 WP_003414006.1.73744 WP_003414006.1.73750 WP_003414006.1.73760 WP_003414006.1.73774 WP_003414006.1.7379 WP_003414006.1.73813 WP_003414006.1.73840 WP_003414006.1.73876 WP_003414006.1.7389 WP_003414006.1.74016 WP_003414006.1.74039 WP_003414006.1.74083 WP_003414006.1.74101 WP_003414006.1.74107 WP_003414006.1.74120 WP_003414006.1.74129 WP_003414006.1.74144 WP_003414006.1.7417 WP_003414006.1.74190 WP_003414006.1.74210 WP_003414006.1.7423 WP_003414006.1.74259 WP_003414006.1.74262 WP_003414006.1.74269 WP_003414006.1.74282 WP_003414006.1.74291 WP_003414006.1.74296 WP_003414006.1.74304 WP_003414006.1.7432 WP_003414006.1.74347 WP_003414006.1.7436 WP_003414006.1.74378 WP_003414006.1.74382 WP_003414006.1.74395 WP_003414006.1.74400 WP_003414006.1.74401 WP_003414006.1.74432 WP_003414006.1.74442 WP_003414006.1.74477 WP_003414006.1.74487 WP_003414006.1.74499 WP_003414006.1.74504 WP_003414006.1.74511 WP_003414006.1.74523 WP_003414006.1.74525 WP_003414006.1.74551 WP_003414006.1.74555 WP_003414006.1.74628 WP_003414006.1.74641 WP_003414006.1.74653 WP_003414006.1.74660 WP_003414006.1.74683 WP_003414006.1.7469 WP_003414006.1.74725 WP_003414006.1.74760 WP_003414006.1.74809 WP_003414006.1.74820 WP_003414006.1.74870 WP_003414006.1.74881 WP_003414006.1.74888 WP_003414006.1.74952 WP_003414006.1.7496 WP_003414006.1.74988 WP_003414006.1.75043 WP_003414006.1.75055 WP_003414006.1.75078 WP_003414006.1.75081 WP_003414006.1.75120 WP_003414006.1.75163 WP_003414006.1.75200 WP_003414006.1.75202 WP_003414006.1.75234 WP_003414006.1.75239 WP_003414006.1.75250 WP_003414006.1.75263 WP_003414006.1.75281 WP_003414006.1.75342 WP_003414006.1.7535 WP_003414006.1.75376 WP_003414006.1.75391 WP_003414006.1.75395 WP_003414006.1.75441 WP_003414006.1.75510 WP_003414006.1.75581 WP_003414006.1.75598 WP_003414006.1.75635 WP_003414006.1.75665 WP_003414006.1.75671 WP_003414006.1.75741 WP_003414006.1.75749 WP_003414006.1.75772 WP_003414006.1.75774 WP_003414006.1.75811 WP_003414006.1.75833 WP_003414006.1.7585 WP_003414006.1.75864 WP_003414006.1.75868 WP_003414006.1.75878 WP_003414006.1.75927 WP_003414006.1.75946 WP_003414006.1.75968 WP_003414006.1.75974 WP_003414006.1.76016 WP_003414006.1.76032 WP_003414006.1.76037 WP_003414006.1.7604 WP_003414006.1.76045 WP_003414006.1.76052 WP_003414006.1.76058 WP_003414006.1.76064 WP_003414006.1.76110 WP_003414006.1.76126 WP_003414006.1.76133 WP_003414006.1.76138 WP_003414006.1.76157 WP_003414006.1.76172 WP_003414006.1.76177 WP_003414006.1.76183 WP_003414006.1.76209 WP_003414006.1.76272 WP_003414006.1.76277 WP_003414006.1.76281 WP_003414006.1.76291 WP_003414006.1.76297 WP_003414006.1.76360 WP_003414006.1.76379 WP_003414006.1.76403 WP_003414006.1.76413 WP_003414006.1.76414 WP_003414006.1.76427 WP_003414006.1.76436 WP_003414006.1.76442 WP_003414006.1.76443 WP_003414006.1.76456 WP_003414006.1.76533 WP_003414006.1.76616 WP_003414006.1.76625 WP_003414006.1.76629 WP_003414006.1.76635 WP_003414006.1.76638 WP_003414006.1.76640 WP_003414006.1.76644 WP_003414006.1.76677 WP_003414006.1.76678 WP_003414006.1.76679 WP_003414006.1.76734 WP_003414006.1.76744 WP_003414006.1.76750 WP_003414006.1.76754 WP_003414006.1.76757 WP_003414006.1.76781 WP_003414006.1.76818 WP_003414006.1.76824 WP_003414006.1.76835 WP_003414006.1.76873 WP_003414006.1.76888 WP_003414006.1.76900 WP_003414006.1.7691 WP_003414006.1.76947 WP_003414006.1.76954 WP_003414006.1.76955 WP_003414006.1.76963 WP_003414006.1.76976 WP_003414006.1.770 WP_003414006.1.77000 WP_003414006.1.77008 WP_003414006.1.77021 WP_003414006.1.77056 WP_003414006.1.77065 WP_003414006.1.77075 WP_003414006.1.77093 WP_003414006.1.77107 WP_003414006.1.77115 WP_003414006.1.77118 WP_003414006.1.77125 WP_003414006.1.77141 WP_003414006.1.77142 WP_003414006.1.77166 WP_003414006.1.77250 WP_003414006.1.77252 WP_003414006.1.77260 WP_003414006.1.77266 WP_003414006.1.77280 WP_003414006.1.77285 WP_003414006.1.77312 WP_003414006.1.77348 WP_003414006.1.77351 WP_003414006.1.77352 WP_003414006.1.77361 WP_003414006.1.774 WP_003414006.1.7740 WP_003414006.1.77404 WP_003414006.1.77425 WP_003414006.1.77463 WP_003414006.1.77474 WP_003414006.1.7748 WP_003414006.1.77491 WP_003414006.1.77499 WP_003414006.1.77510 WP_003414006.1.77530 WP_003414006.1.77554 WP_003414006.1.77559 WP_003414006.1.77599 WP_003414006.1.77605 WP_003414006.1.7762 WP_003414006.1.77627 WP_003414006.1.77649 WP_003414006.1.77654 WP_003414006.1.7766 WP_003414006.1.77667 WP_003414006.1.77704 WP_003414006.1.77706 WP_003414006.1.77774 WP_003414006.1.7778 WP_003414006.1.77790 WP_003414006.1.77809 WP_003414006.1.77820 WP_003414006.1.77855 WP_003414006.1.77865 WP_003414006.1.77868 WP_003414006.1.77879 WP_003414006.1.77909 WP_003414006.1.77911 WP_003414006.1.77931 WP_003414006.1.77984 WP_003414006.1.78020 WP_003414006.1.78024 WP_003414006.1.78075 WP_003414006.1.78086 WP_003414006.1.7809 WP_003414006.1.78098 WP_003414006.1.78105 WP_003414006.1.78113 WP_003414006.1.78136 WP_003414006.1.78162 WP_003414006.1.7817 WP_003414006.1.78200 WP_003414006.1.78216 WP_003414006.1.78236 WP_003414006.1.78238 WP_003414006.1.78322 WP_003414006.1.78338 WP_003414006.1.7836 WP_003414006.1.78360 WP_003414006.1.78386 WP_003414006.1.78429 WP_003414006.1.78435 WP_003414006.1.7844 WP_003414006.1.78459 WP_003414006.1.78488 WP_003414006.1.7849 WP_003414006.1.78499 WP_003414006.1.785 WP_003414006.1.78516 WP_003414006.1.78524 WP_003414006.1.78526 WP_003414006.1.78544 WP_003414006.1.78545 WP_003414006.1.78547 WP_003414006.1.78574 WP_003414006.1.78580 WP_003414006.1.7860 WP_003414006.1.78620 WP_003414006.1.78646 WP_003414006.1.78648 WP_003414006.1.78649 WP_003414006.1.78655 WP_003414006.1.78659 WP_003414006.1.7869 WP_003414006.1.78692 WP_003414006.1.78760 WP_003414006.1.78766 WP_003414006.1.78776 WP_003414006.1.78778 WP_003414006.1.78784 WP_003414006.1.78788 WP_003414006.1.78790 WP_003414006.1.78793 WP_003414006.1.78848 WP_003414006.1.78860 WP_003414006.1.7887 WP_003414006.1.78884 WP_003414006.1.78932 WP_003414006.1.78969 WP_003414006.1.78977 WP_003414006.1.78980 WP_003414006.1.79005 WP_003414006.1.79016 WP_003414006.1.79064 WP_003414006.1.79066 WP_003414006.1.79068 WP_003414006.1.79077 WP_003414006.1.79095 WP_003414006.1.79112 WP_003414006.1.79122 WP_003414006.1.79145 WP_003414006.1.79152 WP_003414006.1.79163 WP_003414006.1.79182 WP_003414006.1.79198 WP_003414006.1.79213 WP_003414006.1.79218 WP_003414006.1.79268 WP_003414006.1.79273 WP_003414006.1.79278 WP_003414006.1.79290 WP_003414006.1.79319 WP_003414006.1.79325 WP_003414006.1.79326 WP_003414006.1.7933 WP_003414006.1.79330 WP_003414006.1.79339 WP_003414006.1.79394 WP_003414006.1.79399 WP_003414006.1.79413 WP_003414006.1.79422 WP_003414006.1.79445 WP_003414006.1.79447 WP_003414006.1.79455 WP_003414006.1.79471 WP_003414006.1.79480 WP_003414006.1.79482 WP_003414006.1.79488 WP_003414006.1.79500 WP_003414006.1.79502 WP_003414006.1.79508 WP_003414006.1.79514 WP_003414006.1.79561 WP_003414006.1.79565 WP_003414006.1.79578 WP_003414006.1.79588 WP_003414006.1.79598 WP_003414006.1.79615 WP_003414006.1.79684 WP_003414006.1.79698 WP_003414006.1.797 WP_003414006.1.79744 WP_003414006.1.79784 WP_003414006.1.79802 WP_003414006.1.79806 WP_003414006.1.79819 WP_003414006.1.79826 WP_003414006.1.79828 WP_003414006.1.79851 WP_003414006.1.79853 WP_003414006.1.79863 WP_003414006.1.79881 WP_003414006.1.79885 WP_003414006.1.79898 WP_003414006.1.7990 WP_003414006.1.79900 WP_003414006.1.79913 WP_003414006.1.79918 WP_003414006.1.79947 WP_003414006.1.79948 WP_003414006.1.7997 WP_003414006.1.80004 WP_003414006.1.80015 WP_003414006.1.80022 WP_003414006.1.80030 WP_003414006.1.80054 WP_003414006.1.80084 WP_003414006.1.80099 WP_003414006.1.80129 WP_003414006.1.80177 WP_003414006.1.80234 WP_003414006.1.8026 WP_003414006.1.80275 WP_003414006.1.8029 WP_003414006.1.80299 WP_003414006.1.80300 WP_003414006.1.80304 WP_003414006.1.80326 WP_003414006.1.80351 WP_003414006.1.80370 WP_003414006.1.80387 WP_003414006.1.80399 WP_003414006.1.8044 WP_003414006.1.80451 WP_003414006.1.80458 WP_003414006.1.80461 WP_003414006.1.80490 WP_003414006.1.80503 WP_003414006.1.80507 WP_003414006.1.80552 WP_003414006.1.80576 WP_003414006.1.80599 WP_003414006.1.8060 WP_003414006.1.80624 WP_003414006.1.80636 WP_003414006.1.80673 WP_003414006.1.80711 WP_003414006.1.80714 WP_003414006.1.80743 WP_003414006.1.80784 WP_003414006.1.80815 WP_003414006.1.80853 WP_003414006.1.80918 WP_003414006.1.8093 WP_003414006.1.8097 WP_003414006.1.80988 WP_003414006.1.81007 WP_003414006.1.81013 WP_003414006.1.8105 WP_003414006.1.81059 WP_003414006.1.81063 WP_003414006.1.81066 WP_003414006.1.81075 WP_003414006.1.81091 WP_003414006.1.81119 WP_003414006.1.81125 WP_003414006.1.81136 WP_003414006.1.8114 WP_003414006.1.81189 WP_003414006.1.81192 WP_003414006.1.812 WP_003414006.1.81230 WP_003414006.1.81249 WP_003414006.1.81250 WP_003414006.1.81264 WP_003414006.1.8128 WP_003414006.1.81297 WP_003414006.1.8138 WP_003414006.1.81407 WP_003414006.1.8143 WP_003414006.1.81439 WP_003414006.1.81465 WP_003414006.1.81529 WP_003414006.1.81538 WP_003414006.1.81541 WP_003414006.1.81560 WP_003414006.1.81567 WP_003414006.1.81583 WP_003414006.1.81712 WP_003414006.1.81720 WP_003414006.1.81731 WP_003414006.1.81774 WP_003414006.1.81788 WP_003414006.1.81809 WP_003414006.1.81820 WP_003414006.1.81850 WP_003414006.1.81883 WP_003414006.1.81891 WP_003414006.1.81911 WP_003414006.1.81918 WP_003414006.1.82011 WP_003414006.1.82048 WP_003414006.1.82069 WP_003414006.1.82071 WP_003414006.1.82108 WP_003414006.1.82136 WP_003414006.1.82142 WP_003414006.1.8215 WP_003414006.1.82158 WP_003414006.1.8217 WP_003414006.1.82209 WP_003414006.1.82210 WP_003414006.1.82228 WP_003414006.1.82236 WP_003414006.1.82251 WP_003414006.1.82271 WP_003414006.1.82305 WP_003414006.1.82307 WP_003414006.1.82317 WP_003414006.1.8232 WP_003414006.1.82346 WP_003414006.1.82374 WP_003414006.1.82385 WP_003414006.1.82429 WP_003414006.1.82460 WP_003414006.1.82462 WP_003414006.1.82483 WP_003414006.1.82494 WP_003414006.1.82546 WP_003414006.1.82547 WP_003414006.1.82549 WP_003414006.1.82577 WP_003414006.1.82592 WP_003414006.1.82597 WP_003414006.1.82598 WP_003414006.1.82625 WP_003414006.1.82642 WP_003414006.1.82651 WP_003414006.1.82653 WP_003414006.1.82681 WP_003414006.1.82685 WP_003414006.1.8271 WP_003414006.1.82712 WP_003414006.1.8273 WP_003414006.1.82743 WP_003414006.1.82757 WP_003414006.1.82774 WP_003414006.1.82803 WP_003414006.1.82860 WP_003414006.1.82871 WP_003414006.1.82892 WP_003414006.1.82935 WP_003414006.1.82957 WP_003414006.1.82981 WP_003414006.1.82983 WP_003414006.1.83004 WP_003414006.1.83009 WP_003414006.1.83044 WP_003414006.1.83065 WP_003414006.1.83074 WP_003414006.1.83146 WP_003414006.1.83149 WP_003414006.1.8317 WP_003414006.1.83173 WP_003414006.1.83181 WP_003414006.1.83182 WP_003414006.1.83191 WP_003414006.1.83197 WP_003414006.1.83212 WP_003414006.1.8326 WP_003414006.1.83262 WP_003414006.1.83268 WP_003414006.1.83273 WP_003414006.1.83309 WP_003414006.1.83332 WP_003414006.1.83334 WP_003414006.1.83341 WP_003414006.1.83349 WP_003414006.1.8335 WP_003414006.1.83353 WP_003414006.1.83367 WP_003414006.1.83380 WP_003414006.1.83381 WP_003414006.1.83389 WP_003414006.1.83408 WP_003414006.1.83409 WP_003414006.1.83435 WP_003414006.1.83470 WP_003414006.1.83524 WP_003414006.1.83526 WP_003414006.1.8358 WP_003414006.1.83589 WP_003414006.1.83601 WP_003414006.1.83611 WP_003414006.1.83638 WP_003414006.1.83648 WP_003414006.1.83656 WP_003414006.1.83667 WP_003414006.1.83689 WP_003414006.1.83692 WP_003414006.1.83704 WP_003414006.1.83705 WP_003414006.1.83766 WP_003414006.1.83793 WP_003414006.1.83794 WP_003414006.1.83802 WP_003414006.1.83805 WP_003414006.1.83839 WP_003414006.1.83842 WP_003414006.1.83850 WP_003414006.1.83861 WP_003414006.1.83884 WP_003414006.1.83920 WP_003414006.1.83930 WP_003414006.1.83975 WP_003414006.1.83991 WP_003414006.1.8400 WP_003414006.1.84027 WP_003414006.1.8404 WP_003414006.1.84057 WP_003414006.1.84070 WP_003414006.1.8409 WP_003414006.1.84112 WP_003414006.1.84146 WP_003414006.1.8415 WP_003414006.1.84176 WP_003414006.1.84186 WP_003414006.1.84192 WP_003414006.1.84228 WP_003414006.1.8424 WP_003414006.1.84244 WP_003414006.1.84259 WP_003414006.1.8426 WP_003414006.1.84277 WP_003414006.1.84287 WP_003414006.1.8434 WP_003414006.1.84388 WP_003414006.1.84408 WP_003414006.1.84409 WP_003414006.1.84438 WP_003414006.1.84460 WP_003414006.1.84488 WP_003414006.1.84504 WP_003414006.1.84620 WP_003414006.1.84641 WP_003414006.1.84655 WP_003414006.1.84666 WP_003414006.1.84670 WP_003414006.1.84739 WP_003414006.1.84748 WP_003414006.1.84766 WP_003414006.1.84772 WP_003414006.1.84774 WP_003414006.1.848 WP_003414006.1.84812 WP_003414006.1.84836 WP_003414006.1.84839 WP_003414006.1.84846 WP_003414006.1.84873 WP_003414006.1.84911 WP_003414006.1.84938 WP_003414006.1.84968 WP_003414006.1.84973 WP_003414006.1.84981 WP_003414006.1.84985 WP_003414006.1.8503 WP_003414006.1.85038 WP_003414006.1.85041 WP_003414006.1.85043 WP_003414006.1.8505 WP_003414006.1.85074 WP_003414006.1.8509 WP_003414006.1.8512 WP_003414006.1.85148 WP_003414006.1.8518 WP_003414006.1.8522 WP_003414006.1.85242 WP_003414006.1.85276 WP_003414006.1.85281 WP_003414006.1.85284 WP_003414006.1.85314 WP_003414006.1.85319 WP_003414006.1.85330 WP_003414006.1.85341 WP_003414006.1.85346 WP_003414006.1.8535 WP_003414006.1.85371 WP_003414006.1.85377 WP_003414006.1.85387 WP_003414006.1.85399 WP_003414006.1.85458 WP_003414006.1.8546 WP_003414006.1.85464 WP_003414006.1.85478 WP_003414006.1.85480 WP_003414006.1.85488 WP_003414006.1.85495 WP_003414006.1.85551 WP_003414006.1.85557 WP_003414006.1.85577 WP_003414006.1.85599 WP_003414006.1.85610 WP_003414006.1.8563 WP_003414006.1.85648 WP_003414006.1.85679 WP_003414006.1.85704 WP_003414006.1.85727 WP_003414006.1.85737 WP_003414006.1.85763 WP_003414006.1.85808 WP_003414006.1.85819 WP_003414006.1.85820 WP_003414006.1.85823 WP_003414006.1.85832 WP_003414006.1.8586 WP_003414006.1.85872 WP_003414006.1.85894 WP_003414006.1.85909 WP_003414006.1.85913 WP_003414006.1.85953 WP_003414006.1.85986 WP_003414006.1.86000 WP_003414006.1.86024 WP_003414006.1.86025 WP_003414006.1.86032 WP_003414006.1.86048 WP_003414006.1.86052 WP_003414006.1.86067 WP_003414006.1.86103 WP_003414006.1.86122 WP_003414006.1.86124 WP_003414006.1.86160 WP_003414006.1.86164 WP_003414006.1.86168 WP_003414006.1.86190 WP_003414006.1.86204 WP_003414006.1.86208 WP_003414006.1.86235 WP_003414006.1.86249 WP_003414006.1.86260 WP_003414006.1.86290 WP_003414006.1.863 WP_003414006.1.86327 WP_003414006.1.86334 WP_003414006.1.86337 WP_003414006.1.86368 WP_003414006.1.86377 WP_003414006.1.86425 WP_003414006.1.86459 WP_003414006.1.8649 WP_003414006.1.86499 WP_003414006.1.86520 WP_003414006.1.86561 WP_003414006.1.86568 WP_003414006.1.86575 WP_003414006.1.86584 WP_003414006.1.86605 WP_003414006.1.86626 WP_003414006.1.86648 WP_003414006.1.8666 WP_003414006.1.86684 WP_003414006.1.86696 WP_003414006.1.86705 WP_003414006.1.86718 WP_003414006.1.86725 WP_003414006.1.86757 WP_003414006.1.86766 WP_003414006.1.86801 WP_003414006.1.86814 WP_003414006.1.86820 WP_003414006.1.86825 WP_003414006.1.86834 WP_003414006.1.8685 WP_003414006.1.86851 WP_003414006.1.86855 WP_003414006.1.86867 WP_003414006.1.86877 WP_003414006.1.86883 WP_003414006.1.8689 WP_003414006.1.86892 WP_003414006.1.86933 WP_003414006.1.86941 WP_003414006.1.86950 WP_003414006.1.86962 WP_003414006.1.86963 WP_003414006.1.86979 WP_003414006.1.8700 WP_003414006.1.87002 WP_003414006.1.87031 WP_003414006.1.87116 WP_003414006.1.87117 WP_003414006.1.8714 WP_003414006.1.87178 WP_003414006.1.87191 WP_003414006.1.87201 WP_003414006.1.87209 WP_003414006.1.87240 WP_003414006.1.87266 WP_003414006.1.87273 WP_003414006.1.87275 WP_003414006.1.8733 WP_003414006.1.87345 WP_003414006.1.8737 WP_003414006.1.87401 WP_003414006.1.87404 WP_003414006.1.87406 WP_003414006.1.87409 WP_003414006.1.87444 WP_003414006.1.87446 WP_003414006.1.87459 WP_003414006.1.87489 WP_003414006.1.87494 WP_003414006.1.87496 WP_003414006.1.87582 WP_003414006.1.87588 WP_003414006.1.87617 WP_003414006.1.87619 WP_003414006.1.87620 WP_003414006.1.87634 WP_003414006.1.87643 WP_003414006.1.8765 WP_003414006.1.87650 WP_003414006.1.87654 WP_003414006.1.87658 WP_003414006.1.87665 WP_003414006.1.87676 WP_003414006.1.87677 WP_003414006.1.87684 WP_003414006.1.87692 WP_003414006.1.87707 WP_003414006.1.87732 WP_003414006.1.87784 WP_003414006.1.87796 WP_003414006.1.87809 WP_003414006.1.87817 WP_003414006.1.87827 WP_003414006.1.87831 WP_003414006.1.87835 WP_003414006.1.87837 WP_003414006.1.87866 WP_003414006.1.8789 WP_003414006.1.87911 WP_003414006.1.87924 WP_003414006.1.87951 WP_003414006.1.87955 WP_003414006.1.87956 WP_003414006.1.87991 WP_003414006.1.88 WP_003414006.1.88002 WP_003414006.1.88037 WP_003414006.1.88039 WP_003414006.1.88072 WP_003414006.1.88077 WP_003414006.1.88121 WP_003414006.1.88180 WP_003414006.1.88191 WP_003414006.1.88205 WP_003414006.1.88217 WP_003414006.1.88219 WP_003414006.1.88253 WP_003414006.1.88294 WP_003414006.1.88315 WP_003414006.1.88316 WP_003414006.1.88320 WP_003414006.1.88338 WP_003414006.1.8840 WP_003414006.1.88437 WP_003414006.1.88453 WP_003414006.1.88469 WP_003414006.1.88489 WP_003414006.1.88507 WP_003414006.1.88521 WP_003414006.1.88530 WP_003414006.1.88541 WP_003414006.1.88592 WP_003414006.1.88616 WP_003414006.1.88618 WP_003414006.1.8862 WP_003414006.1.88625 WP_003414006.1.88632 WP_003414006.1.88634 WP_003414006.1.88649 WP_003414006.1.8870 WP_003414006.1.88737 WP_003414006.1.88756 WP_003414006.1.88824 WP_003414006.1.88886 WP_003414006.1.88965 WP_003414006.1.88985 WP_003414006.1.8902 WP_003414006.1.89025 WP_003414006.1.89041 WP_003414006.1.89046 WP_003414006.1.89082 WP_003414006.1.89162 WP_003414006.1.89168 WP_003414006.1.8917 WP_003414006.1.89193 WP_003414006.1.89205 WP_003414006.1.89207 WP_003414006.1.89225 WP_003414006.1.8925 WP_003414006.1.89277 WP_003414006.1.89286 WP_003414006.1.89293 WP_003414006.1.89320 WP_003414006.1.8935 WP_003414006.1.89371 WP_003414006.1.89378 WP_003414006.1.89392 WP_003414006.1.89406 WP_003414006.1.8943 WP_003414006.1.89451 WP_003414006.1.89453 WP_003414006.1.89473 WP_003414006.1.89475 WP_003414006.1.89483 WP_003414006.1.895 WP_003414006.1.89513 WP_003414006.1.89517 WP_003414006.1.89522 WP_003414006.1.8954 WP_003414006.1.89543 WP_003414006.1.8957 WP_003414006.1.89572 WP_003414006.1.89589 WP_003414006.1.89607 WP_003414006.1.89613 WP_003414006.1.89625 WP_003414006.1.89648 WP_003414006.1.8967 WP_003414006.1.89670 WP_003414006.1.89676 WP_003414006.1.89729 WP_003414006.1.89739 WP_003414006.1.8977 WP_003414006.1.89802 WP_003414006.1.89808 WP_003414006.1.8982 WP_003414006.1.89829 WP_003414006.1.89831 WP_003414006.1.89844 WP_003414006.1.89849 WP_003414006.1.8989 WP_003414006.1.89901 WP_003414006.1.89903 WP_003414006.1.89909 WP_003414006.1.89922 WP_003414006.1.89926 WP_003414006.1.89963 WP_003414006.1.89971 WP_003414006.1.8998 WP_003414006.1.89987 WP_003414006.1.900 WP_003414006.1.90048 WP_003414006.1.9007 WP_003414006.1.90080 WP_003414006.1.90130 WP_003414006.1.90134 WP_003414006.1.90137 WP_003414006.1.90157 WP_003414006.1.90184 WP_003414006.1.90199 WP_003414006.1.90231 WP_003414006.1.90245 WP_003414006.1.90308 WP_003414006.1.90322 WP_003414006.1.90328 WP_003414006.1.90372 WP_003414006.1.90439 WP_003414006.1.90481 WP_003414006.1.90499 WP_003414006.1.9050 WP_003414006.1.90527 WP_003414006.1.90550 WP_003414006.1.90560 WP_003414006.1.90612 WP_003414006.1.90640 WP_003414006.1.90672 WP_003414006.1.90687 WP_003414006.1.90691 WP_003414006.1.90711 WP_003414006.1.90722 WP_003414006.1.90744 WP_003414006.1.9075 WP_003414006.1.90756 WP_003414006.1.90767 WP_003414006.1.90771 WP_003414006.1.90785 WP_003414006.1.90788 WP_003414006.1.90800 WP_003414006.1.90810 WP_003414006.1.90816 WP_003414006.1.90819 WP_003414006.1.9082 WP_003414006.1.90831 WP_003414006.1.90884 WP_003414006.1.90899 WP_003414006.1.90906 WP_003414006.1.90958 WP_003414006.1.90976 WP_003414006.1.90977 WP_003414006.1.90987 WP_003414006.1.9102 WP_003414006.1.91026 WP_003414006.1.91032 WP_003414006.1.91043 WP_003414006.1.91053 WP_003414006.1.91082 WP_003414006.1.91106 WP_003414006.1.91112 WP_003414006.1.91144 WP_003414006.1.91151 WP_003414006.1.91157 WP_003414006.1.91167 WP_003414006.1.91169 WP_003414006.1.91192 WP_003414006.1.91201 WP_003414006.1.91207 WP_003414006.1.91208 WP_003414006.1.91211 WP_003414006.1.91214 WP_003414006.1.91230 WP_003414006.1.91244 WP_003414006.1.91251 WP_003414006.1.91260 WP_003414006.1.91265 WP_003414006.1.9128 WP_003414006.1.91284 WP_003414006.1.91294 WP_003414006.1.91303 WP_003414006.1.91322 WP_003414006.1.91352 WP_003414006.1.91386 WP_003414006.1.9139 WP_003414006.1.91398 WP_003414006.1.91411 WP_003414006.1.91430 WP_003414006.1.91436 WP_003414006.1.91483 WP_003414006.1.91496 WP_003414006.1.91507 WP_003414006.1.91508 WP_003414006.1.91576 WP_003414006.1.91589 WP_003414006.1.91694 WP_003414006.1.91695 WP_003414006.1.91713 WP_003414006.1.91716 WP_003414006.1.91717 WP_003414006.1.91728 WP_003414006.1.91743 WP_003414006.1.91759 WP_003414006.1.91784 WP_003414006.1.91785 WP_003414006.1.91786 WP_003414006.1.91802 WP_003414006.1.91822 WP_003414006.1.91828 WP_003414006.1.9189 WP_003414006.1.91896 WP_003414006.1.9190 WP_003414006.1.91915 WP_003414006.1.91931 WP_003414006.1.91944 WP_003414006.1.91953 WP_003414006.1.91957 WP_003414006.1.91978 WP_003414006.1.92083 WP_003414006.1.92127 WP_003414006.1.92144 WP_003414006.1.92153 WP_003414006.1.92190 WP_003414006.1.92192 WP_003414006.1.92200 WP_003414006.1.92220 WP_003414006.1.92221 WP_003414006.1.92222 WP_003414006.1.92273 WP_003414006.1.92289 WP_003414006.1.9229 WP_003414006.1.92294 WP_003414006.1.92300 WP_003414006.1.92317 WP_003414006.1.92334 WP_003414006.1.92338 WP_003414006.1.92345 WP_003414006.1.92356 WP_003414006.1.92364 WP_003414006.1.92380 WP_003414006.1.92428 WP_003414006.1.92447 WP_003414006.1.92456 WP_003414006.1.92467 WP_003414006.1.92471 WP_003414006.1.92490 WP_003414006.1.92508 WP_003414006.1.9251 WP_003414006.1.92511 WP_003414006.1.92523 WP_003414006.1.92527 WP_003414006.1.92536 WP_003414006.1.92592 WP_003414006.1.92597 WP_003414006.1.92603 WP_003414006.1.92606 WP_003414006.1.92610 WP_003414006.1.92613 WP_003414006.1.9263 WP_003414006.1.9265 WP_003414006.1.92650 WP_003414006.1.92660 WP_003414006.1.92677 WP_003414006.1.92689 WP_003414006.1.92690 WP_003414006.1.92714 WP_003414006.1.92736 WP_003414006.1.9274 WP_003414006.1.92752 WP_003414006.1.92760 WP_003414006.1.92777 WP_003414006.1.92803 WP_003414006.1.92856 WP_003414006.1.92881 WP_003414006.1.92892 WP_003414006.1.92907 WP_003414006.1.92908 WP_003414006.1.9291 WP_003414006.1.92917 WP_003414006.1.92996 WP_003414006.1.93006 WP_003414006.1.93008 WP_003414006.1.93009 WP_003414006.1.93015 WP_003414006.1.93043 WP_003414006.1.9307 WP_003414006.1.93083 WP_003414006.1.93097 WP_003414006.1.93137 WP_003414006.1.93192 WP_003414006.1.93199 WP_003414006.1.93203 WP_003414006.1.93212 WP_003414006.1.93234 WP_003414006.1.93245 WP_003414006.1.93257 WP_003414006.1.93265 WP_003414006.1.93297 WP_003414006.1.93320 WP_003414006.1.93328 WP_003414006.1.93337 WP_003414006.1.93343 WP_003414006.1.93349 WP_003414006.1.93363 WP_003414006.1.93377 WP_003414006.1.9338 WP_003414006.1.93407 WP_003414006.1.93417 WP_003414006.1.93419 WP_003414006.1.93426 WP_003414006.1.9344 WP_003414006.1.93443 WP_003414006.1.93447 WP_003414006.1.93470 WP_003414006.1.93483 WP_003414006.1.93487 WP_003414006.1.93495 WP_003414006.1.93499 WP_003414006.1.93516 WP_003414006.1.93536 WP_003414006.1.93544 WP_003414006.1.93555 WP_003414006.1.93560 WP_003414006.1.93564 WP_003414006.1.9357 WP_003414006.1.93573 WP_003414006.1.93576 WP_003414006.1.93588 WP_003414006.1.9363 WP_003414006.1.93645 WP_003414006.1.93649 WP_003414006.1.93659 WP_003414006.1.93677 WP_003414006.1.9368 WP_003414006.1.93689 WP_003414006.1.93693 WP_003414006.1.93698 WP_003414006.1.93706 WP_003414006.1.9371 WP_003414006.1.93792 WP_003414006.1.93823 WP_003414006.1.93871 WP_003414006.1.9388 WP_003414006.1.93894 WP_003414006.1.93903 WP_003414006.1.93907 WP_003414006.1.93913 WP_003414006.1.93946 WP_003414006.1.93950 WP_003414006.1.93953 WP_003414006.1.93954 WP_003414006.1.93988 WP_003414006.1.9407 WP_003414006.1.94143 WP_003414006.1.94154 WP_003414006.1.94184 WP_003414006.1.94204 WP_003414006.1.94205 WP_003414006.1.94226 WP_003414006.1.94231 WP_003414006.1.94256 WP_003414006.1.94261 WP_003414006.1.94281 WP_003414006.1.94292 WP_003414006.1.94297 WP_003414006.1.9431 WP_003414006.1.94326 WP_003414006.1.94339 WP_003414006.1.94392 WP_003414006.1.94416 WP_003414006.1.94421 WP_003414006.1.94456 WP_003414006.1.94480 WP_003414006.1.94495 WP_003414006.1.94511 WP_003414006.1.94512 WP_003414006.1.94528 WP_003414006.1.94564 WP_003414006.1.946 WP_003414006.1.94602 WP_003414006.1.94623 WP_003414006.1.94629 WP_003414006.1.9465 WP_003414006.1.94673 WP_003414006.1.94714 WP_003414006.1.94730 WP_003414006.1.94776 WP_003414006.1.9478 WP_003414006.1.94872 WP_003414006.1.9488 WP_003414006.1.94902 WP_003414006.1.94916 WP_003414006.1.94979 WP_003414006.1.94994 WP_003414006.1.94996 WP_003414006.1.94998 WP_003414006.1.95007 WP_003414006.1.95010 WP_003414006.1.95015 WP_003414006.1.95034 WP_003414006.1.95068 WP_003414006.1.95081 WP_003414006.1.95082 WP_003414006.1.9509 WP_003414006.1.95096 WP_003414006.1.95112 WP_003414006.1.95138 WP_003414006.1.9514 WP_003414006.1.95179 WP_003414006.1.95188 WP_003414006.1.95190 WP_003414006.1.95234 WP_003414006.1.95241 WP_003414006.1.95245 WP_003414006.1.95257 WP_003414006.1.95279 WP_003414006.1.9531 WP_003414006.1.95335 WP_003414006.1.95344 WP_003414006.1.9535 WP_003414006.1.95370 WP_003414006.1.95392 WP_003414006.1.95416 WP_003414006.1.95417 WP_003414006.1.95454 WP_003414006.1.95455 WP_003414006.1.95491 WP_003414006.1.95508 WP_003414006.1.95509 WP_003414006.1.95529 WP_003414006.1.95556 WP_003414006.1.95557 WP_003414006.1.95565 WP_003414006.1.95578 WP_003414006.1.95580 WP_003414006.1.95585 WP_003414006.1.95643 WP_003414006.1.95679 WP_003414006.1.95685 WP_003414006.1.957 WP_003414006.1.95724 WP_003414006.1.95727 WP_003414006.1.95730 WP_003414006.1.95735 WP_003414006.1.95758 WP_003414006.1.95772 WP_003414006.1.95797 WP_003414006.1.95839 WP_003414006.1.9585 WP_003414006.1.9590 WP_003414006.1.95902 WP_003414006.1.95908 WP_003414006.1.95924 WP_003414006.1.95926 WP_003414006.1.95953 WP_003414006.1.95958 WP_003414006.1.95964 WP_003414006.1.95973 WP_003414006.1.96006 WP_003414006.1.9602 WP_003414006.1.96036 WP_003414006.1.96062 WP_003414006.1.96065 WP_003414006.1.96098 WP_003414006.1.96146 WP_003414006.1.96171 WP_003414006.1.96182 WP_003414006.1.96204 WP_003414006.1.96230 WP_003414006.1.96235 WP_003414006.1.96242 WP_003414006.1.96245 WP_003414006.1.96254 WP_003414006.1.96259 WP_003414006.1.96286 WP_003414006.1.96313 WP_003414006.1.96318 WP_003414006.1.96345 WP_003414006.1.96360 WP_003414006.1.96373 WP_003414006.1.96456 WP_003414006.1.96486 WP_003414006.1.96569 WP_003414006.1.96573 WP_003414006.1.96576 WP_003414006.1.96611 WP_003414006.1.96621 WP_003414006.1.9667 WP_003414006.1.96726 WP_003414006.1.96733 WP_003414006.1.96742 WP_003414006.1.96754 WP_003414006.1.9678 WP_003414006.1.9685 WP_003414006.1.97008 WP_003414006.1.97009 WP_003414006.1.97056 WP_003414006.1.97084 WP_003414006.1.97087 WP_003414006.1.97094 WP_003414006.1.97096 WP_003414006.1.97099 WP_003414006.1.97108 WP_003414006.1.97113 WP_003414006.1.97122 WP_003414006.1.97129 WP_003414006.1.97136 WP_003414006.1.9716 WP_003414006.1.97176 WP_003414006.1.97222 WP_003414006.1.97223 WP_003414006.1.97242 WP_003414006.1.97270 WP_003414006.1.97283 WP_003414006.1.97296 WP_003414006.1.97321 WP_003414006.1.97325 WP_003414006.1.97330 WP_003414006.1.97366 WP_003414006.1.97376 WP_003414006.1.97380 WP_003414006.1.9739 WP_003414006.1.97462 WP_003414006.1.97517 WP_003414006.1.97519 WP_003414006.1.97535 WP_003414006.1.97540 WP_003414006.1.97546 WP_003414006.1.97550 WP_003414006.1.97568 WP_003414006.1.97577 WP_003414006.1.97584 WP_003414006.1.9759 WP_003414006.1.97591 WP_003414006.1.97596 WP_003414006.1.97609 WP_003414006.1.97618 WP_003414006.1.9763 WP_003414006.1.97669 WP_003414006.1.97673 WP_003414006.1.97700 WP_003414006.1.97701 WP_003414006.1.9773 WP_003414006.1.97730 WP_003414006.1.97740 WP_003414006.1.97751 WP_003414006.1.97754 WP_003414006.1.97797 WP_003414006.1.9782 WP_003414006.1.9784 WP_003414006.1.97888 WP_003414006.1.9790 WP_003414006.1.9795 WP_003414006.1.97951 WP_003414006.1.97958 WP_003414006.1.97966 WP_003414006.1.97977 WP_003414006.1.97995 WP_003414006.1.98018 WP_003414006.1.98034 WP_003414006.1.98052 WP_003414006.1.98071 WP_003414006.1.98072 WP_003414006.1.98113 WP_003414006.1.98114 WP_003414006.1.98128 WP_003414006.1.98181 WP_003414006.1.98188 WP_003414006.1.98189 WP_003414006.1.98213 WP_003414006.1.98225 WP_003414006.1.98291 WP_003414006.1.98335 WP_003414006.1.98350 WP_003414006.1.98395 WP_003414006.1.98412 WP_003414006.1.98441 WP_003414006.1.98443 WP_003414006.1.98462 WP_003414006.1.9848 WP_003414006.1.98482 WP_003414006.1.98486 WP_003414006.1.98488 WP_003414006.1.98503 WP_003414006.1.98516 WP_003414006.1.98524 WP_003414006.1.98536 WP_003414006.1.98541 WP_003414006.1.98566 WP_003414006.1.98576 WP_003414006.1.98590 WP_003414006.1.98594 WP_003414006.1.98599 WP_003414006.1.98629 WP_003414006.1.98645 WP_003414006.1.98646 WP_003414006.1.98649 WP_003414006.1.98656 WP_003414006.1.9867 WP_003414006.1.98674 WP_003414006.1.98697 WP_003414006.1.98701 WP_003414006.1.98739 WP_003414006.1.98749 WP_003414006.1.98765 WP_003414006.1.98770 WP_003414006.1.98777 WP_003414006.1.98778 WP_003414006.1.98838 WP_003414006.1.98850 WP_003414006.1.98906 WP_003414006.1.98935 WP_003414006.1.98948 WP_003414006.1.98953 WP_003414006.1.98984 WP_003414006.1.99000 WP_003414006.1.99023 WP_003414006.1.99030 WP_003414006.1.99037 WP_003414006.1.99055 WP_003414006.1.99062 WP_003414006.1.99086 WP_003414006.1.99115 WP_003414006.1.99117 WP_003414006.1.99161 WP_003414006.1.99176 WP_003414006.1.99205 WP_003414006.1.99211 WP_003414006.1.99216 WP_003414006.1.99222 WP_003414006.1.99251 WP_003414006.1.99269 WP_003414006.1.99294 WP_003414006.1.99312 WP_003414006.1.99315 WP_003414006.1.99316 WP_003414006.1.99322 WP_003414006.1.99328 WP_003414006.1.99365 WP_003414006.1.99368 WP_003414006.1.99396 WP_003414006.1.99402 WP_003414006.1.99404 WP_003414006.1.99419 WP_003414006.1.99438 WP_003414006.1.99460 WP_003414006.1.99468 WP_003414006.1.99473 WP_003414006.1.99513 WP_003414006.1.99529 WP_003414006.1.99548 WP_003414006.1.99572 WP_003414006.1.99575 WP_003414006.1.99578 WP_003414006.1.99605 WP_003414006.1.99609 WP_003414006.1.99617 WP_003414006.1.99635 WP_003414006.1.99650 WP_003414006.1.99672 WP_003414006.1.99701 WP_003414006.1.99711 WP_003414006.1.99716 WP_003414006.1.99740 WP_003414006.1.99745 WP_003414006.1.99749 WP_003414006.1.9976 WP_003414006.1.99798 WP_003414006.1.99817 WP_003414006.1.99847 WP_003414006.1.99852 WP_003414006.1.99886 WP_003414006.1.99897 WP_003414006.1.99899 WP_003414006.1.99915 WP_003414006.1.9993 WP_003414006.1.99991 gi|392431658|ref|YP_006472702.1| gi|385999517|ref|YP_005917816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]