SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15609920|ref|NP_217299.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15609920|ref|NP_217299.1|
Domain Number 1 Region: 329-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-44
Family Ribonuclease PH domain 1-like 0.00000164
Further Details:      
 
Domain Number 2 Region: 13-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-43
Family Ribonuclease PH domain 1-like 0.000000378
Further Details:      
 
Domain Number 3 Region: 157-259
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-25
Family Ribonuclease PH domain 2-like 0.000014
Further Details:      
 
Domain Number 4 Region: 481-588
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-23
Family Ribonuclease PH domain 2-like 0.0000188
Further Details:      
 
Domain Number 5 Region: 258-356
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.62e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00019
Further Details:      
 
Domain Number 6 Region: 597-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 7 Region: 663-732
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000656
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15609920|ref|NP_217299.1|
Sequence length 752
Comment Bifunctional protein polyribonucleotide nucleotidyltransferase GpsI: guanosine pentaphosphate synthetase + polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) (pnpase) [Mycobacterium tuberculosis H37Rv]
Sequence
MSAAEIDEGVFETTATIDNGSFGTRTIRFETGRLALQAAGAVVAYLDDDNMLLSATTASK
NPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLRPSFVDGLR
NEIQIVVTILSLDPGDLYDVLAINAASASTQLGGLPFSGPIGGVRVALIDGTWVGFPTVD
QIERAVFDMVVAGRIVEGDVAIMMVEAEATENVVELVEGGAQAPTESVVAAGLEAAKPFI
AALCTAQQELADAAGKSGKPTVDFPVFPDYGEDVYYSVSSVATDELAAALTIGGKAERDQ
RIDEIKTQVVQRLADTYEGREKEVGAALRALTKKLVRQRILTDHFRIDGRGITDIRALSA
EVAVVPRAHGSALFERGETQILGVTTLDMIKMAQQIDSLGPETSKRYMHHYNFPPFSTGE
TGRVGSPKRREIGHGALAERALVPVLPSVEEFPYAIRQVSEALGSNGSTSMGSVCASTLA
LLNAGVPLKAPVAGIAMGLVSDDIQVEGAVDGVVERRFVTLTDILGAEDAFGDMDFKVAG
TKDFVTALQLDTKLDGIPSQVLAGALEQAKDARLTILEVMAEAIDRPDEMSPYAPRVTTI
KVPVDKIGEVIGPKGKVINAITEETGAQISIEDDGTVFVGATDGPSAQAAIDKINAIANP
QLPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVVNVGDKLRVE
IADIDKRGKISLILVADEDSTAAATDAATVTS
Download sequence
Identical sequences A0A045JHZ4 A0A083VWQ4 A0A0H3LCS0 A0A197J2W8 A1KMC6 A5U6D6 C1AFP7 F8M3N8 I6Y1P7 M8DDN0 P9WI56 P9WI57 Q7TXW0 R4MH25
gi|121638663|ref|YP_978887.1| gi|385992057|ref|YP_005910355.1| gi|378772518|ref|YP_005172251.1| gi|31793959|ref|NP_856452.1| gi|15609920|ref|NP_217299.1| gi|375295401|ref|YP_005099668.1| gi|471338793|ref|YP_007611506.1| gi|224991155|ref|YP_002645844.1| gi|494697151|ref|YP_007962654.1| Rv2783c gi|148662625|ref|YP_001284148.1| gi|253798133|ref|YP_003031134.1| gi|339632794|ref|YP_004724436.1| NP_217299.1.84033 WP_003414124.1.100000 WP_003414124.1.100021 WP_003414124.1.100069 WP_003414124.1.100087 WP_003414124.1.10015 WP_003414124.1.100208 WP_003414124.1.100216 WP_003414124.1.100255 WP_003414124.1.100260 WP_003414124.1.100270 WP_003414124.1.100279 WP_003414124.1.100286 WP_003414124.1.100308 WP_003414124.1.100309 WP_003414124.1.100318 WP_003414124.1.100338 WP_003414124.1.10037 WP_003414124.1.100383 WP_003414124.1.100396 WP_003414124.1.1004 WP_003414124.1.100401 WP_003414124.1.100459 WP_003414124.1.100460 WP_003414124.1.100552 WP_003414124.1.100600 WP_003414124.1.100625 WP_003414124.1.10064 WP_003414124.1.100666 WP_003414124.1.100671 WP_003414124.1.100677 WP_003414124.1.100697 WP_003414124.1.100703 WP_003414124.1.100716 WP_003414124.1.100722 WP_003414124.1.100754 WP_003414124.1.100757 WP_003414124.1.100772 WP_003414124.1.1008 WP_003414124.1.100812 WP_003414124.1.100845 WP_003414124.1.100866 WP_003414124.1.10088 WP_003414124.1.100889 WP_003414124.1.10090 WP_003414124.1.100910 WP_003414124.1.100915 WP_003414124.1.100918 WP_003414124.1.100935 WP_003414124.1.100984 WP_003414124.1.100998 WP_003414124.1.101 WP_003414124.1.101025 WP_003414124.1.101028 WP_003414124.1.10104 WP_003414124.1.101048 WP_003414124.1.101054 WP_003414124.1.101075 WP_003414124.1.101143 WP_003414124.1.101146 WP_003414124.1.10116 WP_003414124.1.10117 WP_003414124.1.101209 WP_003414124.1.10125 WP_003414124.1.101290 WP_003414124.1.101323 WP_003414124.1.101324 WP_003414124.1.101350 WP_003414124.1.101367 WP_003414124.1.101398 WP_003414124.1.101403 WP_003414124.1.101421 WP_003414124.1.10144 WP_003414124.1.101442 WP_003414124.1.10145 WP_003414124.1.101452 WP_003414124.1.101456 WP_003414124.1.101493 WP_003414124.1.101496 WP_003414124.1.101525 WP_003414124.1.101533 WP_003414124.1.101535 WP_003414124.1.101553 WP_003414124.1.101558 WP_003414124.1.10156 WP_003414124.1.101573 WP_003414124.1.101576 WP_003414124.1.10159 WP_003414124.1.101592 WP_003414124.1.101604 WP_003414124.1.101622 WP_003414124.1.101644 WP_003414124.1.101659 WP_003414124.1.101671 WP_003414124.1.101687 WP_003414124.1.101698 WP_003414124.1.10170 WP_003414124.1.101713 WP_003414124.1.101722 WP_003414124.1.101733 WP_003414124.1.101743 WP_003414124.1.101753 WP_003414124.1.101754 WP_003414124.1.101764 WP_003414124.1.101773 WP_003414124.1.101795 WP_003414124.1.101797 WP_003414124.1.101798 WP_003414124.1.101802 WP_003414124.1.101826 WP_003414124.1.101836 WP_003414124.1.101858 WP_003414124.1.101859 WP_003414124.1.101862 WP_003414124.1.101888 WP_003414124.1.101894 WP_003414124.1.101899 WP_003414124.1.1019 WP_003414124.1.101923 WP_003414124.1.101925 WP_003414124.1.10193 WP_003414124.1.101996 WP_003414124.1.102 WP_003414124.1.102008 WP_003414124.1.102017 WP_003414124.1.102053 WP_003414124.1.102055 WP_003414124.1.102063 WP_003414124.1.102099 WP_003414124.1.1021 WP_003414124.1.10211 WP_003414124.1.102119 WP_003414124.1.102121 WP_003414124.1.102143 WP_003414124.1.10216 WP_003414124.1.10224 WP_003414124.1.10253 WP_003414124.1.10262 WP_003414124.1.10277 WP_003414124.1.1033 WP_003414124.1.10350 WP_003414124.1.10362 WP_003414124.1.10366 WP_003414124.1.10376 WP_003414124.1.10396 WP_003414124.1.10410 WP_003414124.1.10414 WP_003414124.1.10421 WP_003414124.1.10430 WP_003414124.1.1044 WP_003414124.1.10440 WP_003414124.1.10445 WP_003414124.1.10471 WP_003414124.1.10472 WP_003414124.1.10489 WP_003414124.1.105 WP_003414124.1.10518 WP_003414124.1.10523 WP_003414124.1.10545 WP_003414124.1.1057 WP_003414124.1.10594 WP_003414124.1.10603 WP_003414124.1.10606 WP_003414124.1.10615 WP_003414124.1.10623 WP_003414124.1.10635 WP_003414124.1.10643 WP_003414124.1.10648 WP_003414124.1.10662 WP_003414124.1.10709 WP_003414124.1.10735 WP_003414124.1.10740 WP_003414124.1.10756 WP_003414124.1.1078 WP_003414124.1.10791 WP_003414124.1.10799 WP_003414124.1.10825 WP_003414124.1.10848 WP_003414124.1.10863 WP_003414124.1.10879 WP_003414124.1.10912 WP_003414124.1.10916 WP_003414124.1.10923 WP_003414124.1.10927 WP_003414124.1.1095 WP_003414124.1.10956 WP_003414124.1.10958 WP_003414124.1.10962 WP_003414124.1.10980 WP_003414124.1.10981 WP_003414124.1.10993 WP_003414124.1.1100 WP_003414124.1.11040 WP_003414124.1.11061 WP_003414124.1.11070 WP_003414124.1.11171 WP_003414124.1.11175 WP_003414124.1.11176 WP_003414124.1.11222 WP_003414124.1.11236 WP_003414124.1.11329 WP_003414124.1.1133 WP_003414124.1.11373 WP_003414124.1.11376 WP_003414124.1.11390 WP_003414124.1.11402 WP_003414124.1.11481 WP_003414124.1.11489 WP_003414124.1.11514 WP_003414124.1.11587 WP_003414124.1.11589 WP_003414124.1.11596 WP_003414124.1.11604 WP_003414124.1.11610 WP_003414124.1.11697 WP_003414124.1.11707 WP_003414124.1.11752 WP_003414124.1.11758 WP_003414124.1.11761 WP_003414124.1.11775 WP_003414124.1.11804 WP_003414124.1.11826 WP_003414124.1.11856 WP_003414124.1.11898 WP_003414124.1.11906 WP_003414124.1.11939 WP_003414124.1.11960 WP_003414124.1.11961 WP_003414124.1.11972 WP_003414124.1.11984 WP_003414124.1.120 WP_003414124.1.12001 WP_003414124.1.12049 WP_003414124.1.12052 WP_003414124.1.12100 WP_003414124.1.12116 WP_003414124.1.12133 WP_003414124.1.12161 WP_003414124.1.12165 WP_003414124.1.12184 WP_003414124.1.12187 WP_003414124.1.12190 WP_003414124.1.12216 WP_003414124.1.12265 WP_003414124.1.12275 WP_003414124.1.12293 WP_003414124.1.12294 WP_003414124.1.123 WP_003414124.1.1231 WP_003414124.1.12314 WP_003414124.1.12327 WP_003414124.1.12338 WP_003414124.1.1236 WP_003414124.1.12371 WP_003414124.1.12372 WP_003414124.1.12389 WP_003414124.1.12406 WP_003414124.1.1241 WP_003414124.1.12421 WP_003414124.1.12446 WP_003414124.1.12464 WP_003414124.1.12479 WP_003414124.1.12519 WP_003414124.1.12523 WP_003414124.1.12526 WP_003414124.1.1255 WP_003414124.1.12550 WP_003414124.1.12551 WP_003414124.1.12563 WP_003414124.1.12611 WP_003414124.1.12669 WP_003414124.1.1267 WP_003414124.1.12672 WP_003414124.1.12692 WP_003414124.1.1271 WP_003414124.1.12710 WP_003414124.1.12768 WP_003414124.1.1279 WP_003414124.1.12794 WP_003414124.1.12801 WP_003414124.1.12804 WP_003414124.1.12821 WP_003414124.1.12841 WP_003414124.1.12854 WP_003414124.1.12871 WP_003414124.1.12901 WP_003414124.1.12941 WP_003414124.1.12947 WP_003414124.1.12957 WP_003414124.1.12972 WP_003414124.1.13028 WP_003414124.1.13043 WP_003414124.1.13086 WP_003414124.1.13087 WP_003414124.1.13090 WP_003414124.1.13096 WP_003414124.1.13163 WP_003414124.1.13175 WP_003414124.1.13183 WP_003414124.1.132 WP_003414124.1.13249 WP_003414124.1.13282 WP_003414124.1.13284 WP_003414124.1.13296 WP_003414124.1.13298 WP_003414124.1.13306 WP_003414124.1.13312 WP_003414124.1.13321 WP_003414124.1.13345 WP_003414124.1.13358 WP_003414124.1.13370 WP_003414124.1.13375 WP_003414124.1.1338 WP_003414124.1.13420 WP_003414124.1.13433 WP_003414124.1.13435 WP_003414124.1.13438 WP_003414124.1.13461 WP_003414124.1.13466 WP_003414124.1.13489 WP_003414124.1.13551 WP_003414124.1.13561 WP_003414124.1.13564 WP_003414124.1.13579 WP_003414124.1.13647 WP_003414124.1.13697 WP_003414124.1.13719 WP_003414124.1.13763 WP_003414124.1.1377 WP_003414124.1.13774 WP_003414124.1.13786 WP_003414124.1.13793 WP_003414124.1.13794 WP_003414124.1.13817 WP_003414124.1.13834 WP_003414124.1.13866 WP_003414124.1.13880 WP_003414124.1.13899 WP_003414124.1.13909 WP_003414124.1.13910 WP_003414124.1.13919 WP_003414124.1.13920 WP_003414124.1.13952 WP_003414124.1.13953 WP_003414124.1.13962 WP_003414124.1.1398 WP_003414124.1.13988 WP_003414124.1.14027 WP_003414124.1.14046 WP_003414124.1.14115 WP_003414124.1.1415 WP_003414124.1.14152 WP_003414124.1.14158 WP_003414124.1.14162 WP_003414124.1.14175 WP_003414124.1.14178 WP_003414124.1.14194 WP_003414124.1.14195 WP_003414124.1.14208 WP_003414124.1.14238 WP_003414124.1.14266 WP_003414124.1.14273 WP_003414124.1.14303 WP_003414124.1.14306 WP_003414124.1.14307 WP_003414124.1.14310 WP_003414124.1.14382 WP_003414124.1.14416 WP_003414124.1.14428 WP_003414124.1.14441 WP_003414124.1.14469 WP_003414124.1.14477 WP_003414124.1.14504 WP_003414124.1.14514 WP_003414124.1.1452 WP_003414124.1.14527 WP_003414124.1.14544 WP_003414124.1.14548 WP_003414124.1.14551 WP_003414124.1.14561 WP_003414124.1.14573 WP_003414124.1.1462 WP_003414124.1.14658 WP_003414124.1.14667 WP_003414124.1.14668 WP_003414124.1.14675 WP_003414124.1.14694 WP_003414124.1.14695 WP_003414124.1.14709 WP_003414124.1.14766 WP_003414124.1.14783 WP_003414124.1.14865 WP_003414124.1.14872 WP_003414124.1.14905 WP_003414124.1.14926 WP_003414124.1.14951 WP_003414124.1.14955 WP_003414124.1.15003 WP_003414124.1.15009 WP_003414124.1.15028 WP_003414124.1.15040 WP_003414124.1.15065 WP_003414124.1.15072 WP_003414124.1.15089 WP_003414124.1.1509 WP_003414124.1.15126 WP_003414124.1.15131 WP_003414124.1.15174 WP_003414124.1.15187 WP_003414124.1.15196 WP_003414124.1.15210 WP_003414124.1.15216 WP_003414124.1.15217 WP_003414124.1.1523 WP_003414124.1.15232 WP_003414124.1.15238 WP_003414124.1.15240 WP_003414124.1.15253 WP_003414124.1.15267 WP_003414124.1.1527 WP_003414124.1.15292 WP_003414124.1.15299 WP_003414124.1.15302 WP_003414124.1.15322 WP_003414124.1.1534 WP_003414124.1.15345 WP_003414124.1.15365 WP_003414124.1.15386 WP_003414124.1.15387 WP_003414124.1.15442 WP_003414124.1.15447 WP_003414124.1.15449 WP_003414124.1.15477 WP_003414124.1.15481 WP_003414124.1.15492 WP_003414124.1.15511 WP_003414124.1.15512 WP_003414124.1.15558 WP_003414124.1.15559 WP_003414124.1.15566 WP_003414124.1.15599 WP_003414124.1.1560 WP_003414124.1.15611 WP_003414124.1.1563 WP_003414124.1.15633 WP_003414124.1.15643 WP_003414124.1.15688 WP_003414124.1.15755 WP_003414124.1.15763 WP_003414124.1.15774 WP_003414124.1.1578 WP_003414124.1.15780 WP_003414124.1.15834 WP_003414124.1.15842 WP_003414124.1.15848 WP_003414124.1.15853 WP_003414124.1.15870 WP_003414124.1.15877 WP_003414124.1.15893 WP_003414124.1.15896 WP_003414124.1.15926 WP_003414124.1.15933 WP_003414124.1.15946 WP_003414124.1.15958 WP_003414124.1.15973 WP_003414124.1.15987 WP_003414124.1.15993 WP_003414124.1.16009 WP_003414124.1.16025 WP_003414124.1.16043 WP_003414124.1.16055 WP_003414124.1.16066 WP_003414124.1.16069 WP_003414124.1.16077 WP_003414124.1.16106 WP_003414124.1.16108 WP_003414124.1.16130 WP_003414124.1.16136 WP_003414124.1.16139 WP_003414124.1.16141 WP_003414124.1.16143 WP_003414124.1.1630 WP_003414124.1.16318 WP_003414124.1.1632 WP_003414124.1.16327 WP_003414124.1.16334 WP_003414124.1.16341 WP_003414124.1.16345 WP_003414124.1.16374 WP_003414124.1.16384 WP_003414124.1.16386 WP_003414124.1.164 WP_003414124.1.1642 WP_003414124.1.16424 WP_003414124.1.16426 WP_003414124.1.16431 WP_003414124.1.16438 WP_003414124.1.16448 WP_003414124.1.16451 WP_003414124.1.16476 WP_003414124.1.16480 WP_003414124.1.16494 WP_003414124.1.1652 WP_003414124.1.16549 WP_003414124.1.16560 WP_003414124.1.16598 WP_003414124.1.16609 WP_003414124.1.16619 WP_003414124.1.16620 WP_003414124.1.16622 WP_003414124.1.16637 WP_003414124.1.1669 WP_003414124.1.16707 WP_003414124.1.16731 WP_003414124.1.16743 WP_003414124.1.1683 WP_003414124.1.16837 WP_003414124.1.16852 WP_003414124.1.16937 WP_003414124.1.16940 WP_003414124.1.16950 WP_003414124.1.16959 WP_003414124.1.16968 WP_003414124.1.1697 WP_003414124.1.16973 WP_003414124.1.16987 WP_003414124.1.17005 WP_003414124.1.17006 WP_003414124.1.17010 WP_003414124.1.17015 WP_003414124.1.17019 WP_003414124.1.17039 WP_003414124.1.17041 WP_003414124.1.17052 WP_003414124.1.17057 WP_003414124.1.17062 WP_003414124.1.1707 WP_003414124.1.17094 WP_003414124.1.17130 WP_003414124.1.17138 WP_003414124.1.17147 WP_003414124.1.17224 WP_003414124.1.17251 WP_003414124.1.17288 WP_003414124.1.17304 WP_003414124.1.17314 WP_003414124.1.17345 WP_003414124.1.17381 WP_003414124.1.17391 WP_003414124.1.17412 WP_003414124.1.1743 WP_003414124.1.17440 WP_003414124.1.17466 WP_003414124.1.17477 WP_003414124.1.17483 WP_003414124.1.17505 WP_003414124.1.17527 WP_003414124.1.17535 WP_003414124.1.17540 WP_003414124.1.17553 WP_003414124.1.17558 WP_003414124.1.17599 WP_003414124.1.17635 WP_003414124.1.17655 WP_003414124.1.17679 WP_003414124.1.1768 WP_003414124.1.17687 WP_003414124.1.17700 WP_003414124.1.17710 WP_003414124.1.17713 WP_003414124.1.17722 WP_003414124.1.17746 WP_003414124.1.17788 WP_003414124.1.17798 WP_003414124.1.17803 WP_003414124.1.17821 WP_003414124.1.17830 WP_003414124.1.17868 WP_003414124.1.17878 WP_003414124.1.1792 WP_003414124.1.17923 WP_003414124.1.1795 WP_003414124.1.17955 WP_003414124.1.17973 WP_003414124.1.18009 WP_003414124.1.18033 WP_003414124.1.18057 WP_003414124.1.18065 WP_003414124.1.18070 WP_003414124.1.18116 WP_003414124.1.18120 WP_003414124.1.18126 WP_003414124.1.1817 WP_003414124.1.18170 WP_003414124.1.18206 WP_003414124.1.18240 WP_003414124.1.18257 WP_003414124.1.18297 WP_003414124.1.18306 WP_003414124.1.18364 WP_003414124.1.18399 WP_003414124.1.18411 WP_003414124.1.18444 WP_003414124.1.18448 WP_003414124.1.18476 WP_003414124.1.18522 WP_003414124.1.18580 WP_003414124.1.18582 WP_003414124.1.18587 WP_003414124.1.186 WP_003414124.1.18601 WP_003414124.1.18639 WP_003414124.1.18646 WP_003414124.1.18647 WP_003414124.1.1868 WP_003414124.1.18694 WP_003414124.1.18710 WP_003414124.1.18751 WP_003414124.1.18793 WP_003414124.1.18804 WP_003414124.1.18816 WP_003414124.1.18823 WP_003414124.1.18827 WP_003414124.1.18838 WP_003414124.1.18849 WP_003414124.1.18856 WP_003414124.1.18945 WP_003414124.1.1898 WP_003414124.1.19005 WP_003414124.1.19056 WP_003414124.1.19066 WP_003414124.1.19071 WP_003414124.1.19085 WP_003414124.1.19094 WP_003414124.1.19144 WP_003414124.1.19159 WP_003414124.1.19193 WP_003414124.1.19231 WP_003414124.1.19243 WP_003414124.1.19295 WP_003414124.1.19307 WP_003414124.1.19326 WP_003414124.1.1933 WP_003414124.1.19364 WP_003414124.1.19382 WP_003414124.1.19400 WP_003414124.1.19426 WP_003414124.1.19429 WP_003414124.1.19464 WP_003414124.1.19480 WP_003414124.1.19553 WP_003414124.1.19562 WP_003414124.1.19564 WP_003414124.1.19568 WP_003414124.1.19572 WP_003414124.1.19595 WP_003414124.1.19596 WP_003414124.1.19600 WP_003414124.1.19630 WP_003414124.1.1967 WP_003414124.1.19694 WP_003414124.1.1970 WP_003414124.1.19707 WP_003414124.1.19742 WP_003414124.1.19785 WP_003414124.1.19820 WP_003414124.1.19868 WP_003414124.1.19874 WP_003414124.1.19890 WP_003414124.1.19900 WP_003414124.1.19922 WP_003414124.1.19936 WP_003414124.1.19946 WP_003414124.1.19949 WP_003414124.1.19960 WP_003414124.1.19964 WP_003414124.1.20007 WP_003414124.1.20016 WP_003414124.1.2003 WP_003414124.1.20037 WP_003414124.1.20039 WP_003414124.1.20082 WP_003414124.1.20085 WP_003414124.1.20097 WP_003414124.1.20116 WP_003414124.1.20130 WP_003414124.1.20140 WP_003414124.1.20141 WP_003414124.1.20142 WP_003414124.1.20158 WP_003414124.1.20239 WP_003414124.1.20243 WP_003414124.1.20259 WP_003414124.1.20262 WP_003414124.1.20273 WP_003414124.1.20280 WP_003414124.1.20294 WP_003414124.1.20300 WP_003414124.1.20309 WP_003414124.1.20322 WP_003414124.1.2037 WP_003414124.1.20372 WP_003414124.1.20381 WP_003414124.1.204 WP_003414124.1.20427 WP_003414124.1.20432 WP_003414124.1.20457 WP_003414124.1.20459 WP_003414124.1.20460 WP_003414124.1.20542 WP_003414124.1.20578 WP_003414124.1.20608 WP_003414124.1.20624 WP_003414124.1.20628 WP_003414124.1.2066 WP_003414124.1.20707 WP_003414124.1.20722 WP_003414124.1.20729 WP_003414124.1.20742 WP_003414124.1.20751 WP_003414124.1.20843 WP_003414124.1.20850 WP_003414124.1.2086 WP_003414124.1.20868 WP_003414124.1.20876 WP_003414124.1.20897 WP_003414124.1.20898 WP_003414124.1.2090 WP_003414124.1.20911 WP_003414124.1.20921 WP_003414124.1.20926 WP_003414124.1.20927 WP_003414124.1.20951 WP_003414124.1.20970 WP_003414124.1.2104 WP_003414124.1.21070 WP_003414124.1.21127 WP_003414124.1.21135 WP_003414124.1.21173 WP_003414124.1.21187 WP_003414124.1.212 WP_003414124.1.2120 WP_003414124.1.21219 WP_003414124.1.2123 WP_003414124.1.21231 WP_003414124.1.21234 WP_003414124.1.2126 WP_003414124.1.21292 WP_003414124.1.21307 WP_003414124.1.2131 WP_003414124.1.21311 WP_003414124.1.21321 WP_003414124.1.21365 WP_003414124.1.2137 WP_003414124.1.21392 WP_003414124.1.21397 WP_003414124.1.21403 WP_003414124.1.21415 WP_003414124.1.21418 WP_003414124.1.21430 WP_003414124.1.21434 WP_003414124.1.21444 WP_003414124.1.21468 WP_003414124.1.21498 WP_003414124.1.21509 WP_003414124.1.21513 WP_003414124.1.21560 WP_003414124.1.21565 WP_003414124.1.21602 WP_003414124.1.21615 WP_003414124.1.21638 WP_003414124.1.21639 WP_003414124.1.21655 WP_003414124.1.21658 WP_003414124.1.2168 WP_003414124.1.2174 WP_003414124.1.21741 WP_003414124.1.21742 WP_003414124.1.21777 WP_003414124.1.21786 WP_003414124.1.21795 WP_003414124.1.218 WP_003414124.1.21826 WP_003414124.1.21829 WP_003414124.1.21840 WP_003414124.1.21843 WP_003414124.1.21873 WP_003414124.1.2188 WP_003414124.1.21882 WP_003414124.1.21906 WP_003414124.1.21912 WP_003414124.1.2194 WP_003414124.1.21941 WP_003414124.1.21956 WP_003414124.1.21958 WP_003414124.1.21960 WP_003414124.1.21971 WP_003414124.1.21973 WP_003414124.1.21983 WP_003414124.1.22003 WP_003414124.1.22013 WP_003414124.1.22025 WP_003414124.1.22036 WP_003414124.1.22075 WP_003414124.1.2212 WP_003414124.1.22127 WP_003414124.1.22140 WP_003414124.1.22233 WP_003414124.1.22255 WP_003414124.1.22277 WP_003414124.1.22305 WP_003414124.1.22348 WP_003414124.1.22356 WP_003414124.1.22366 WP_003414124.1.2238 WP_003414124.1.22380 WP_003414124.1.22437 WP_003414124.1.22438 WP_003414124.1.22445 WP_003414124.1.22511 WP_003414124.1.22524 WP_003414124.1.22585 WP_003414124.1.22589 WP_003414124.1.22606 WP_003414124.1.22608 WP_003414124.1.22609 WP_003414124.1.22618 WP_003414124.1.2262 WP_003414124.1.22624 WP_003414124.1.22629 WP_003414124.1.22647 WP_003414124.1.22664 WP_003414124.1.22665 WP_003414124.1.22670 WP_003414124.1.22680 WP_003414124.1.22725 WP_003414124.1.22728 WP_003414124.1.22733 WP_003414124.1.22737 WP_003414124.1.22754 WP_003414124.1.22797 WP_003414124.1.22800 WP_003414124.1.22804 WP_003414124.1.22840 WP_003414124.1.22844 WP_003414124.1.22970 WP_003414124.1.22996 WP_003414124.1.22999 WP_003414124.1.23015 WP_003414124.1.23032 WP_003414124.1.231 WP_003414124.1.23101 WP_003414124.1.2312 WP_003414124.1.23140 WP_003414124.1.23153 WP_003414124.1.23171 WP_003414124.1.2320 WP_003414124.1.23204 WP_003414124.1.23216 WP_003414124.1.23229 WP_003414124.1.23233 WP_003414124.1.2326 WP_003414124.1.23261 WP_003414124.1.23272 WP_003414124.1.23289 WP_003414124.1.2329 WP_003414124.1.23308 WP_003414124.1.23316 WP_003414124.1.23321 WP_003414124.1.23325 WP_003414124.1.2339 WP_003414124.1.23406 WP_003414124.1.23438 WP_003414124.1.23445 WP_003414124.1.23447 WP_003414124.1.23452 WP_003414124.1.23461 WP_003414124.1.2349 WP_003414124.1.23496 WP_003414124.1.23497 WP_003414124.1.23506 WP_003414124.1.23530 WP_003414124.1.23539 WP_003414124.1.23546 WP_003414124.1.23551 WP_003414124.1.23573 WP_003414124.1.23583 WP_003414124.1.23588 WP_003414124.1.23628 WP_003414124.1.23677 WP_003414124.1.23683 WP_003414124.1.23692 WP_003414124.1.23694 WP_003414124.1.2371 WP_003414124.1.23803 WP_003414124.1.23807 WP_003414124.1.23825 WP_003414124.1.23832 WP_003414124.1.2384 WP_003414124.1.23843 WP_003414124.1.23863 WP_003414124.1.2387 WP_003414124.1.2400 WP_003414124.1.24007 WP_003414124.1.24008 WP_003414124.1.24046 WP_003414124.1.24057 WP_003414124.1.24062 WP_003414124.1.24113 WP_003414124.1.24119 WP_003414124.1.24128 WP_003414124.1.24140 WP_003414124.1.24176 WP_003414124.1.24190 WP_003414124.1.24202 WP_003414124.1.24261 WP_003414124.1.24284 WP_003414124.1.24294 WP_003414124.1.24357 WP_003414124.1.24396 WP_003414124.1.24423 WP_003414124.1.2443 WP_003414124.1.24446 WP_003414124.1.24461 WP_003414124.1.24500 WP_003414124.1.24507 WP_003414124.1.24509 WP_003414124.1.24529 WP_003414124.1.24553 WP_003414124.1.24629 WP_003414124.1.24638 WP_003414124.1.2466 WP_003414124.1.24824 WP_003414124.1.24831 WP_003414124.1.24840 WP_003414124.1.24848 WP_003414124.1.24857 WP_003414124.1.2487 WP_003414124.1.24893 WP_003414124.1.24907 WP_003414124.1.24933 WP_003414124.1.24956 WP_003414124.1.24958 WP_003414124.1.24985 WP_003414124.1.2499 WP_003414124.1.25004 WP_003414124.1.2505 WP_003414124.1.2507 WP_003414124.1.25096 WP_003414124.1.25103 WP_003414124.1.25129 WP_003414124.1.25171 WP_003414124.1.25184 WP_003414124.1.25247 WP_003414124.1.25278 WP_003414124.1.25309 WP_003414124.1.25313 WP_003414124.1.25338 WP_003414124.1.25342 WP_003414124.1.25367 WP_003414124.1.25393 WP_003414124.1.25406 WP_003414124.1.25435 WP_003414124.1.25445 WP_003414124.1.25455 WP_003414124.1.25473 WP_003414124.1.25504 WP_003414124.1.25513 WP_003414124.1.25542 WP_003414124.1.25579 WP_003414124.1.25594 WP_003414124.1.25606 WP_003414124.1.25645 WP_003414124.1.2566 WP_003414124.1.25673 WP_003414124.1.25674 WP_003414124.1.25693 WP_003414124.1.25699 WP_003414124.1.25727 WP_003414124.1.25736 WP_003414124.1.25738 WP_003414124.1.25756 WP_003414124.1.25759 WP_003414124.1.2580 WP_003414124.1.25813 WP_003414124.1.25853 WP_003414124.1.25854 WP_003414124.1.25874 WP_003414124.1.25885 WP_003414124.1.25892 WP_003414124.1.25906 WP_003414124.1.25914 WP_003414124.1.25916 WP_003414124.1.2594 WP_003414124.1.25954 WP_003414124.1.25965 WP_003414124.1.25972 WP_003414124.1.26017 WP_003414124.1.26032 WP_003414124.1.26038 WP_003414124.1.26072 WP_003414124.1.26089 WP_003414124.1.26097 WP_003414124.1.26098 WP_003414124.1.26108 WP_003414124.1.26109 WP_003414124.1.26118 WP_003414124.1.26126 WP_003414124.1.2614 WP_003414124.1.26168 WP_003414124.1.26182 WP_003414124.1.26190 WP_003414124.1.2620 WP_003414124.1.26243 WP_003414124.1.26265 WP_003414124.1.26267 WP_003414124.1.26292 WP_003414124.1.26310 WP_003414124.1.26328 WP_003414124.1.26349 WP_003414124.1.26366 WP_003414124.1.26374 WP_003414124.1.26407 WP_003414124.1.26412 WP_003414124.1.26454 WP_003414124.1.26464 WP_003414124.1.2653 WP_003414124.1.26560 WP_003414124.1.26571 WP_003414124.1.2659 WP_003414124.1.26597 WP_003414124.1.26603 WP_003414124.1.26629 WP_003414124.1.26651 WP_003414124.1.26702 WP_003414124.1.26707 WP_003414124.1.26710 WP_003414124.1.26719 WP_003414124.1.26737 WP_003414124.1.26738 WP_003414124.1.26745 WP_003414124.1.26756 WP_003414124.1.2676 WP_003414124.1.2677 WP_003414124.1.26779 WP_003414124.1.26780 WP_003414124.1.26798 WP_003414124.1.26854 WP_003414124.1.26868 WP_003414124.1.26888 WP_003414124.1.26914 WP_003414124.1.26945 WP_003414124.1.26959 WP_003414124.1.26969 WP_003414124.1.26984 WP_003414124.1.26992 WP_003414124.1.27004 WP_003414124.1.27017 WP_003414124.1.27045 WP_003414124.1.27074 WP_003414124.1.27075 WP_003414124.1.27128 WP_003414124.1.27130 WP_003414124.1.27139 WP_003414124.1.27152 WP_003414124.1.27162 WP_003414124.1.27164 WP_003414124.1.27193 WP_003414124.1.27235 WP_003414124.1.27254 WP_003414124.1.27278 WP_003414124.1.27343 WP_003414124.1.27352 WP_003414124.1.27369 WP_003414124.1.27391 WP_003414124.1.27398 WP_003414124.1.27402 WP_003414124.1.27410 WP_003414124.1.27411 WP_003414124.1.27449 WP_003414124.1.27460 WP_003414124.1.27463 WP_003414124.1.2749 WP_003414124.1.27492 WP_003414124.1.27528 WP_003414124.1.27541 WP_003414124.1.27576 WP_003414124.1.27582 WP_003414124.1.27596 WP_003414124.1.27607 WP_003414124.1.2766 WP_003414124.1.277 WP_003414124.1.27724 WP_003414124.1.27730 WP_003414124.1.27743 WP_003414124.1.27750 WP_003414124.1.27771 WP_003414124.1.27779 WP_003414124.1.27795 WP_003414124.1.27819 WP_003414124.1.27915 WP_003414124.1.27935 WP_003414124.1.27962 WP_003414124.1.28053 WP_003414124.1.28092 WP_003414124.1.28106 WP_003414124.1.28131 WP_003414124.1.28142 WP_003414124.1.28159 WP_003414124.1.2816 WP_003414124.1.28161 WP_003414124.1.28192 WP_003414124.1.28202 WP_003414124.1.28241 WP_003414124.1.28251 WP_003414124.1.28255 WP_003414124.1.28269 WP_003414124.1.28276 WP_003414124.1.28293 WP_003414124.1.28331 WP_003414124.1.28367 WP_003414124.1.28378 WP_003414124.1.28391 WP_003414124.1.2842 WP_003414124.1.28448 WP_003414124.1.2847 WP_003414124.1.28471 WP_003414124.1.28473 WP_003414124.1.28493 WP_003414124.1.28497 WP_003414124.1.28530 WP_003414124.1.28545 WP_003414124.1.28561 WP_003414124.1.28567 WP_003414124.1.28585 WP_003414124.1.286 WP_003414124.1.28610 WP_003414124.1.28617 WP_003414124.1.28634 WP_003414124.1.28642 WP_003414124.1.28671 WP_003414124.1.28682 WP_003414124.1.28698 WP_003414124.1.28703 WP_003414124.1.28739 WP_003414124.1.28758 WP_003414124.1.28781 WP_003414124.1.28787 WP_003414124.1.28827 WP_003414124.1.28839 WP_003414124.1.28847 WP_003414124.1.28850 WP_003414124.1.28851 WP_003414124.1.28865 WP_003414124.1.28897 WP_003414124.1.28914 WP_003414124.1.28935 WP_003414124.1.28936 WP_003414124.1.28939 WP_003414124.1.28943 WP_003414124.1.28952 WP_003414124.1.28975 WP_003414124.1.2899 WP_003414124.1.28993 WP_003414124.1.29000 WP_003414124.1.2901 WP_003414124.1.29028 WP_003414124.1.29033 WP_003414124.1.29058 WP_003414124.1.29078 WP_003414124.1.29102 WP_003414124.1.29115 WP_003414124.1.2916 WP_003414124.1.29217 WP_003414124.1.29223 WP_003414124.1.29234 WP_003414124.1.29264 WP_003414124.1.29275 WP_003414124.1.29306 WP_003414124.1.29339 WP_003414124.1.29348 WP_003414124.1.29364 WP_003414124.1.29367 WP_003414124.1.2938 WP_003414124.1.29399 WP_003414124.1.29426 WP_003414124.1.2944 WP_003414124.1.29449 WP_003414124.1.29450 WP_003414124.1.29452 WP_003414124.1.2949 WP_003414124.1.29510 WP_003414124.1.29515 WP_003414124.1.29525 WP_003414124.1.2953 WP_003414124.1.29559 WP_003414124.1.29587 WP_003414124.1.2959 WP_003414124.1.29592 WP_003414124.1.29599 WP_003414124.1.29611 WP_003414124.1.29632 WP_003414124.1.29649 WP_003414124.1.2965 WP_003414124.1.29659 WP_003414124.1.2969 WP_003414124.1.29696 WP_003414124.1.29698 WP_003414124.1.29718 WP_003414124.1.29742 WP_003414124.1.29745 WP_003414124.1.29747 WP_003414124.1.29769 WP_003414124.1.29825 WP_003414124.1.29830 WP_003414124.1.29847 WP_003414124.1.29861 WP_003414124.1.29869 WP_003414124.1.29883 WP_003414124.1.299 WP_003414124.1.29931 WP_003414124.1.29960 WP_003414124.1.30014 WP_003414124.1.3004 WP_003414124.1.30040 WP_003414124.1.30043 WP_003414124.1.30097 WP_003414124.1.30106 WP_003414124.1.30114 WP_003414124.1.30126 WP_003414124.1.30131 WP_003414124.1.30138 WP_003414124.1.30139 WP_003414124.1.30145 WP_003414124.1.30235 WP_003414124.1.30237 WP_003414124.1.3027 WP_003414124.1.30279 WP_003414124.1.30282 WP_003414124.1.30283 WP_003414124.1.30288 WP_003414124.1.30291 WP_003414124.1.30363 WP_003414124.1.30374 WP_003414124.1.30404 WP_003414124.1.30433 WP_003414124.1.30438 WP_003414124.1.30462 WP_003414124.1.30464 WP_003414124.1.30468 WP_003414124.1.30500 WP_003414124.1.3057 WP_003414124.1.30574 WP_003414124.1.30628 WP_003414124.1.30641 WP_003414124.1.30642 WP_003414124.1.30661 WP_003414124.1.30669 WP_003414124.1.30683 WP_003414124.1.30699 WP_003414124.1.30709 WP_003414124.1.30713 WP_003414124.1.30716 WP_003414124.1.30719 WP_003414124.1.30730 WP_003414124.1.30732 WP_003414124.1.30736 WP_003414124.1.30745 WP_003414124.1.30760 WP_003414124.1.30791 WP_003414124.1.308 WP_003414124.1.30807 WP_003414124.1.30818 WP_003414124.1.30824 WP_003414124.1.30848 WP_003414124.1.30877 WP_003414124.1.30888 WP_003414124.1.30901 WP_003414124.1.30903 WP_003414124.1.30912 WP_003414124.1.30913 WP_003414124.1.30914 WP_003414124.1.30919 WP_003414124.1.30977 WP_003414124.1.3100 WP_003414124.1.31002 WP_003414124.1.3101 WP_003414124.1.31034 WP_003414124.1.31047 WP_003414124.1.31074 WP_003414124.1.31102 WP_003414124.1.31127 WP_003414124.1.31184 WP_003414124.1.31199 WP_003414124.1.31226 WP_003414124.1.31230 WP_003414124.1.31233 WP_003414124.1.31263 WP_003414124.1.31264 WP_003414124.1.31270 WP_003414124.1.31287 WP_003414124.1.31290 WP_003414124.1.31348 WP_003414124.1.31354 WP_003414124.1.31390 WP_003414124.1.31414 WP_003414124.1.31417 WP_003414124.1.31428 WP_003414124.1.3143 WP_003414124.1.31458 WP_003414124.1.31483 WP_003414124.1.3149 WP_003414124.1.31498 WP_003414124.1.31507 WP_003414124.1.31537 WP_003414124.1.31548 WP_003414124.1.31569 WP_003414124.1.31573 WP_003414124.1.316 WP_003414124.1.31629 WP_003414124.1.31666 WP_003414124.1.31693 WP_003414124.1.31703 WP_003414124.1.31744 WP_003414124.1.31745 WP_003414124.1.31770 WP_003414124.1.31776 WP_003414124.1.31783 WP_003414124.1.318 WP_003414124.1.3184 WP_003414124.1.31840 WP_003414124.1.31880 WP_003414124.1.31911 WP_003414124.1.31930 WP_003414124.1.31932 WP_003414124.1.31955 WP_003414124.1.31985 WP_003414124.1.31991 WP_003414124.1.31995 WP_003414124.1.32004 WP_003414124.1.32039 WP_003414124.1.3204 WP_003414124.1.32045 WP_003414124.1.32071 WP_003414124.1.32098 WP_003414124.1.32132 WP_003414124.1.32157 WP_003414124.1.32164 WP_003414124.1.32179 WP_003414124.1.32198 WP_003414124.1.32297 WP_003414124.1.32383 WP_003414124.1.32400 WP_003414124.1.32403 WP_003414124.1.32416 WP_003414124.1.32421 WP_003414124.1.32433 WP_003414124.1.32461 WP_003414124.1.32482 WP_003414124.1.32503 WP_003414124.1.32556 WP_003414124.1.32562 WP_003414124.1.32569 WP_003414124.1.32592 WP_003414124.1.32620 WP_003414124.1.32647 WP_003414124.1.32653 WP_003414124.1.32654 WP_003414124.1.3268 WP_003414124.1.32695 WP_003414124.1.32706 WP_003414124.1.32716 WP_003414124.1.32752 WP_003414124.1.32780 WP_003414124.1.32781 WP_003414124.1.32793 WP_003414124.1.32799 WP_003414124.1.32822 WP_003414124.1.32833 WP_003414124.1.32862 WP_003414124.1.32880 WP_003414124.1.32897 WP_003414124.1.32909 WP_003414124.1.32935 WP_003414124.1.32974 WP_003414124.1.33007 WP_003414124.1.3302 WP_003414124.1.33028 WP_003414124.1.33044 WP_003414124.1.33054 WP_003414124.1.33082 WP_003414124.1.33141 WP_003414124.1.33148 WP_003414124.1.33155 WP_003414124.1.3321 WP_003414124.1.33215 WP_003414124.1.3325 WP_003414124.1.3327 WP_003414124.1.33278 WP_003414124.1.33288 WP_003414124.1.33305 WP_003414124.1.3331 WP_003414124.1.33319 WP_003414124.1.3333 WP_003414124.1.33393 WP_003414124.1.33403 WP_003414124.1.33452 WP_003414124.1.33467 WP_003414124.1.33477 WP_003414124.1.3349 WP_003414124.1.33519 WP_003414124.1.33542 WP_003414124.1.33601 WP_003414124.1.33602 WP_003414124.1.33633 WP_003414124.1.33646 WP_003414124.1.33673 WP_003414124.1.3369 WP_003414124.1.33705 WP_003414124.1.33762 WP_003414124.1.33783 WP_003414124.1.33789 WP_003414124.1.3383 WP_003414124.1.33832 WP_003414124.1.33839 WP_003414124.1.33848 WP_003414124.1.3387 WP_003414124.1.33886 WP_003414124.1.33895 WP_003414124.1.33912 WP_003414124.1.33954 WP_003414124.1.34042 WP_003414124.1.3405 WP_003414124.1.34055 WP_003414124.1.34056 WP_003414124.1.34065 WP_003414124.1.3408 WP_003414124.1.34090 WP_003414124.1.34109 WP_003414124.1.34111 WP_003414124.1.34152 WP_003414124.1.34163 WP_003414124.1.34181 WP_003414124.1.34197 WP_003414124.1.34198 WP_003414124.1.34215 WP_003414124.1.34219 WP_003414124.1.34255 WP_003414124.1.34260 WP_003414124.1.34275 WP_003414124.1.343 WP_003414124.1.34347 WP_003414124.1.34358 WP_003414124.1.34392 WP_003414124.1.344 WP_003414124.1.34428 WP_003414124.1.3443 WP_003414124.1.34435 WP_003414124.1.34446 WP_003414124.1.34499 WP_003414124.1.34505 WP_003414124.1.34516 WP_003414124.1.34529 WP_003414124.1.34551 WP_003414124.1.34563 WP_003414124.1.34576 WP_003414124.1.34581 WP_003414124.1.34588 WP_003414124.1.34596 WP_003414124.1.34599 WP_003414124.1.34639 WP_003414124.1.34724 WP_003414124.1.34740 WP_003414124.1.34755 WP_003414124.1.34777 WP_003414124.1.34783 WP_003414124.1.34841 WP_003414124.1.34908 WP_003414124.1.3492 WP_003414124.1.34933 WP_003414124.1.34945 WP_003414124.1.34946 WP_003414124.1.34954 WP_003414124.1.34960 WP_003414124.1.34961 WP_003414124.1.34963 WP_003414124.1.34965 WP_003414124.1.34968 WP_003414124.1.35023 WP_003414124.1.35069 WP_003414124.1.35072 WP_003414124.1.35078 WP_003414124.1.35156 WP_003414124.1.35160 WP_003414124.1.35162 WP_003414124.1.35173 WP_003414124.1.35176 WP_003414124.1.3520 WP_003414124.1.35221 WP_003414124.1.35246 WP_003414124.1.35278 WP_003414124.1.35301 WP_003414124.1.35311 WP_003414124.1.35312 WP_003414124.1.35317 WP_003414124.1.35319 WP_003414124.1.35347 WP_003414124.1.35363 WP_003414124.1.35382 WP_003414124.1.35385 WP_003414124.1.35396 WP_003414124.1.35397 WP_003414124.1.35426 WP_003414124.1.35439 WP_003414124.1.35455 WP_003414124.1.3548 WP_003414124.1.35484 WP_003414124.1.35492 WP_003414124.1.3553 WP_003414124.1.35553 WP_003414124.1.35555 WP_003414124.1.35561 WP_003414124.1.35602 WP_003414124.1.35610 WP_003414124.1.35635 WP_003414124.1.35657 WP_003414124.1.35687 WP_003414124.1.35689 WP_003414124.1.35707 WP_003414124.1.35732 WP_003414124.1.35754 WP_003414124.1.35767 WP_003414124.1.35770 WP_003414124.1.35771 WP_003414124.1.35780 WP_003414124.1.35805 WP_003414124.1.35811 WP_003414124.1.35821 WP_003414124.1.3584 WP_003414124.1.35848 WP_003414124.1.35864 WP_003414124.1.35874 WP_003414124.1.35876 WP_003414124.1.35899 WP_003414124.1.35923 WP_003414124.1.35954 WP_003414124.1.36005 WP_003414124.1.36014 WP_003414124.1.36023 WP_003414124.1.36051 WP_003414124.1.36053 WP_003414124.1.36075 WP_003414124.1.36089 WP_003414124.1.36097 WP_003414124.1.36098 WP_003414124.1.36116 WP_003414124.1.36145 WP_003414124.1.36205 WP_003414124.1.36228 WP_003414124.1.36246 WP_003414124.1.36252 WP_003414124.1.36260 WP_003414124.1.36271 WP_003414124.1.36303 WP_003414124.1.36309 WP_003414124.1.36315 WP_003414124.1.36319 WP_003414124.1.36321 WP_003414124.1.36326 WP_003414124.1.3634 WP_003414124.1.36356 WP_003414124.1.36357 WP_003414124.1.3636 WP_003414124.1.36385 WP_003414124.1.36399 WP_003414124.1.36436 WP_003414124.1.36469 WP_003414124.1.36473 WP_003414124.1.36485 WP_003414124.1.36508 WP_003414124.1.36540 WP_003414124.1.36561 WP_003414124.1.36571 WP_003414124.1.36573 WP_003414124.1.36578 WP_003414124.1.36585 WP_003414124.1.36597 WP_003414124.1.36614 WP_003414124.1.36657 WP_003414124.1.36674 WP_003414124.1.36720 WP_003414124.1.36727 WP_003414124.1.36733 WP_003414124.1.36785 WP_003414124.1.36810 WP_003414124.1.36851 WP_003414124.1.36862 WP_003414124.1.36893 WP_003414124.1.36901 WP_003414124.1.36921 WP_003414124.1.36935 WP_003414124.1.36941 WP_003414124.1.3695 WP_003414124.1.36968 WP_003414124.1.37004 WP_003414124.1.37012 WP_003414124.1.37071 WP_003414124.1.37088 WP_003414124.1.37131 WP_003414124.1.37157 WP_003414124.1.37175 WP_003414124.1.37188 WP_003414124.1.37213 WP_003414124.1.37229 WP_003414124.1.3724 WP_003414124.1.37277 WP_003414124.1.37305 WP_003414124.1.37330 WP_003414124.1.37400 WP_003414124.1.37440 WP_003414124.1.37459 WP_003414124.1.37468 WP_003414124.1.37475 WP_003414124.1.37484 WP_003414124.1.37601 WP_003414124.1.37612 WP_003414124.1.37643 WP_003414124.1.37655 WP_003414124.1.37660 WP_003414124.1.37700 WP_003414124.1.37701 WP_003414124.1.37709 WP_003414124.1.37711 WP_003414124.1.37721 WP_003414124.1.37747 WP_003414124.1.37765 WP_003414124.1.37772 WP_003414124.1.37804 WP_003414124.1.37809 WP_003414124.1.37859 WP_003414124.1.37877 WP_003414124.1.37913 WP_003414124.1.37943 WP_003414124.1.37950 WP_003414124.1.37973 WP_003414124.1.37975 WP_003414124.1.37983 WP_003414124.1.38 WP_003414124.1.38002 WP_003414124.1.3802 WP_003414124.1.38039 WP_003414124.1.38040 WP_003414124.1.38067 WP_003414124.1.38068 WP_003414124.1.38135 WP_003414124.1.38138 WP_003414124.1.38144 WP_003414124.1.38158 WP_003414124.1.38159 WP_003414124.1.38233 WP_003414124.1.38240 WP_003414124.1.38299 WP_003414124.1.38332 WP_003414124.1.38347 WP_003414124.1.38354 WP_003414124.1.38389 WP_003414124.1.38398 WP_003414124.1.38402 WP_003414124.1.38418 WP_003414124.1.38466 WP_003414124.1.38477 WP_003414124.1.38483 WP_003414124.1.3849 WP_003414124.1.385 WP_003414124.1.38530 WP_003414124.1.38535 WP_003414124.1.38539 WP_003414124.1.38594 WP_003414124.1.38611 WP_003414124.1.38638 WP_003414124.1.38639 WP_003414124.1.38646 WP_003414124.1.38648 WP_003414124.1.38654 WP_003414124.1.38660 WP_003414124.1.38666 WP_003414124.1.38672 WP_003414124.1.38750 WP_003414124.1.38772 WP_003414124.1.38812 WP_003414124.1.38821 WP_003414124.1.38844 WP_003414124.1.38863 WP_003414124.1.38865 WP_003414124.1.38873 WP_003414124.1.3889 WP_003414124.1.38894 WP_003414124.1.38909 WP_003414124.1.38939 WP_003414124.1.38974 WP_003414124.1.38975 WP_003414124.1.38991 WP_003414124.1.39025 WP_003414124.1.39070 WP_003414124.1.39106 WP_003414124.1.39165 WP_003414124.1.39174 WP_003414124.1.39176 WP_003414124.1.39178 WP_003414124.1.39190 WP_003414124.1.39201 WP_003414124.1.39207 WP_003414124.1.39236 WP_003414124.1.39239 WP_003414124.1.39252 WP_003414124.1.39288 WP_003414124.1.39295 WP_003414124.1.39306 WP_003414124.1.39359 WP_003414124.1.39364 WP_003414124.1.39400 WP_003414124.1.39447 WP_003414124.1.3945 WP_003414124.1.39450 WP_003414124.1.39455 WP_003414124.1.3949 WP_003414124.1.39521 WP_003414124.1.39560 WP_003414124.1.39592 WP_003414124.1.39593 WP_003414124.1.396 WP_003414124.1.3960 WP_003414124.1.39616 WP_003414124.1.39654 WP_003414124.1.39657 WP_003414124.1.39661 WP_003414124.1.39674 WP_003414124.1.39678 WP_003414124.1.3968 WP_003414124.1.39694 WP_003414124.1.3971 WP_003414124.1.39718 WP_003414124.1.39728 WP_003414124.1.39739 WP_003414124.1.39748 WP_003414124.1.39751 WP_003414124.1.39759 WP_003414124.1.39801 WP_003414124.1.39804 WP_003414124.1.39848 WP_003414124.1.39877 WP_003414124.1.39925 WP_003414124.1.3994 WP_003414124.1.39959 WP_003414124.1.3996 WP_003414124.1.39960 WP_003414124.1.3997 WP_003414124.1.39980 WP_003414124.1.40000 WP_003414124.1.40028 WP_003414124.1.4003 WP_003414124.1.40094 WP_003414124.1.40150 WP_003414124.1.40156 WP_003414124.1.40174 WP_003414124.1.40186 WP_003414124.1.40276 WP_003414124.1.40277 WP_003414124.1.40323 WP_003414124.1.40336 WP_003414124.1.40353 WP_003414124.1.4036 WP_003414124.1.40372 WP_003414124.1.40402 WP_003414124.1.40413 WP_003414124.1.40440 WP_003414124.1.40446 WP_003414124.1.40451 WP_003414124.1.40455 WP_003414124.1.40523 WP_003414124.1.40641 WP_003414124.1.40646 WP_003414124.1.40651 WP_003414124.1.40653 WP_003414124.1.4067 WP_003414124.1.40705 WP_003414124.1.40723 WP_003414124.1.40731 WP_003414124.1.40735 WP_003414124.1.40795 WP_003414124.1.40799 WP_003414124.1.40852 WP_003414124.1.40876 WP_003414124.1.40881 WP_003414124.1.40922 WP_003414124.1.4095 WP_003414124.1.40956 WP_003414124.1.40957 WP_003414124.1.40964 WP_003414124.1.4097 WP_003414124.1.410 WP_003414124.1.41000 WP_003414124.1.41055 WP_003414124.1.41108 WP_003414124.1.41123 WP_003414124.1.41202 WP_003414124.1.41219 WP_003414124.1.41231 WP_003414124.1.41249 WP_003414124.1.4127 WP_003414124.1.41355 WP_003414124.1.41376 WP_003414124.1.41430 WP_003414124.1.41469 WP_003414124.1.41504 WP_003414124.1.41553 WP_003414124.1.41564 WP_003414124.1.41583 WP_003414124.1.41632 WP_003414124.1.41635 WP_003414124.1.41636 WP_003414124.1.41648 WP_003414124.1.41660 WP_003414124.1.41685 WP_003414124.1.41695 WP_003414124.1.41704 WP_003414124.1.41719 WP_003414124.1.41733 WP_003414124.1.41744 WP_003414124.1.41774 WP_003414124.1.41791 WP_003414124.1.41803 WP_003414124.1.41820 WP_003414124.1.41828 WP_003414124.1.41829 WP_003414124.1.41860 WP_003414124.1.41912 WP_003414124.1.41921 WP_003414124.1.41944 WP_003414124.1.42043 WP_003414124.1.42075 WP_003414124.1.42078 WP_003414124.1.42112 WP_003414124.1.4212 WP_003414124.1.42122 WP_003414124.1.42134 WP_003414124.1.42183 WP_003414124.1.42188 WP_003414124.1.42201 WP_003414124.1.42202 WP_003414124.1.42208 WP_003414124.1.42247 WP_003414124.1.42255 WP_003414124.1.42273 WP_003414124.1.42278 WP_003414124.1.42304 WP_003414124.1.42309 WP_003414124.1.42370 WP_003414124.1.42385 WP_003414124.1.42400 WP_003414124.1.42414 WP_003414124.1.42417 WP_003414124.1.42430 WP_003414124.1.42461 WP_003414124.1.42465 WP_003414124.1.42467 WP_003414124.1.42473 WP_003414124.1.42474 WP_003414124.1.4248 WP_003414124.1.42494 WP_003414124.1.42519 WP_003414124.1.42524 WP_003414124.1.42534 WP_003414124.1.42562 WP_003414124.1.42568 WP_003414124.1.42570 WP_003414124.1.42618 WP_003414124.1.42660 WP_003414124.1.42695 WP_003414124.1.42704 WP_003414124.1.42705 WP_003414124.1.42722 WP_003414124.1.42782 WP_003414124.1.42835 WP_003414124.1.42839 WP_003414124.1.42842 WP_003414124.1.42905 WP_003414124.1.42916 WP_003414124.1.42930 WP_003414124.1.42971 WP_003414124.1.43005 WP_003414124.1.43009 WP_003414124.1.43053 WP_003414124.1.43082 WP_003414124.1.43087 WP_003414124.1.43098 WP_003414124.1.43208 WP_003414124.1.43236 WP_003414124.1.43246 WP_003414124.1.43255 WP_003414124.1.43266 WP_003414124.1.43269 WP_003414124.1.43273 WP_003414124.1.43296 WP_003414124.1.43306 WP_003414124.1.4335 WP_003414124.1.43368 WP_003414124.1.43395 WP_003414124.1.43457 WP_003414124.1.43462 WP_003414124.1.43475 WP_003414124.1.43478 WP_003414124.1.43557 WP_003414124.1.43588 WP_003414124.1.43643 WP_003414124.1.43664 WP_003414124.1.43684 WP_003414124.1.43686 WP_003414124.1.43706 WP_003414124.1.43716 WP_003414124.1.4377 WP_003414124.1.43781 WP_003414124.1.43794 WP_003414124.1.43815 WP_003414124.1.43846 WP_003414124.1.43861 WP_003414124.1.43863 WP_003414124.1.43866 WP_003414124.1.43872 WP_003414124.1.43885 WP_003414124.1.43897 WP_003414124.1.4390 WP_003414124.1.43902 WP_003414124.1.43921 WP_003414124.1.43936 WP_003414124.1.43937 WP_003414124.1.43960 WP_003414124.1.43965 WP_003414124.1.4399 WP_003414124.1.43993 WP_003414124.1.43996 WP_003414124.1.44 WP_003414124.1.44001 WP_003414124.1.44008 WP_003414124.1.44016 WP_003414124.1.44033 WP_003414124.1.44037 WP_003414124.1.44070 WP_003414124.1.44071 WP_003414124.1.44076 WP_003414124.1.44104 WP_003414124.1.44111 WP_003414124.1.44124 WP_003414124.1.44169 WP_003414124.1.44219 WP_003414124.1.44237 WP_003414124.1.44277 WP_003414124.1.44279 WP_003414124.1.44336 WP_003414124.1.44355 WP_003414124.1.44358 WP_003414124.1.4438 WP_003414124.1.44390 WP_003414124.1.44392 WP_003414124.1.4441 WP_003414124.1.44415 WP_003414124.1.44466 WP_003414124.1.44489 WP_003414124.1.44492 WP_003414124.1.44494 WP_003414124.1.44500 WP_003414124.1.44519 WP_003414124.1.44532 WP_003414124.1.44534 WP_003414124.1.44562 WP_003414124.1.44597 WP_003414124.1.44600 WP_003414124.1.44602 WP_003414124.1.4464 WP_003414124.1.44651 WP_003414124.1.44659 WP_003414124.1.44665 WP_003414124.1.44700 WP_003414124.1.44713 WP_003414124.1.44735 WP_003414124.1.44757 WP_003414124.1.4476 WP_003414124.1.44761 WP_003414124.1.44767 WP_003414124.1.44776 WP_003414124.1.44779 WP_003414124.1.44786 WP_003414124.1.44808 WP_003414124.1.44864 WP_003414124.1.44901 WP_003414124.1.44908 WP_003414124.1.44913 WP_003414124.1.4492 WP_003414124.1.44939 WP_003414124.1.44979 WP_003414124.1.44981 WP_003414124.1.45002 WP_003414124.1.45011 WP_003414124.1.45081 WP_003414124.1.45113 WP_003414124.1.45129 WP_003414124.1.45135 WP_003414124.1.45147 WP_003414124.1.45168 WP_003414124.1.4517 WP_003414124.1.45181 WP_003414124.1.45185 WP_003414124.1.45192 WP_003414124.1.45200 WP_003414124.1.45205 WP_003414124.1.45211 WP_003414124.1.45249 WP_003414124.1.4526 WP_003414124.1.45286 WP_003414124.1.45347 WP_003414124.1.45374 WP_003414124.1.45390 WP_003414124.1.454 WP_003414124.1.45407 WP_003414124.1.45451 WP_003414124.1.45453 WP_003414124.1.45460 WP_003414124.1.45463 WP_003414124.1.45470 WP_003414124.1.45491 WP_003414124.1.45510 WP_003414124.1.45563 WP_003414124.1.45584 WP_003414124.1.45619 WP_003414124.1.45626 WP_003414124.1.45631 WP_003414124.1.45666 WP_003414124.1.45697 WP_003414124.1.4571 WP_003414124.1.45731 WP_003414124.1.45743 WP_003414124.1.45765 WP_003414124.1.45776 WP_003414124.1.45805 WP_003414124.1.45815 WP_003414124.1.45849 WP_003414124.1.45867 WP_003414124.1.4590 WP_003414124.1.45923 WP_003414124.1.45926 WP_003414124.1.45989 WP_003414124.1.45992 WP_003414124.1.46025 WP_003414124.1.46083 WP_003414124.1.46090 WP_003414124.1.46092 WP_003414124.1.46100 WP_003414124.1.46101 WP_003414124.1.46103 WP_003414124.1.46107 WP_003414124.1.46128 WP_003414124.1.46129 WP_003414124.1.46141 WP_003414124.1.46150 WP_003414124.1.46201 WP_003414124.1.46226 WP_003414124.1.4624 WP_003414124.1.46253 WP_003414124.1.46268 WP_003414124.1.46285 WP_003414124.1.46300 WP_003414124.1.46313 WP_003414124.1.46336 WP_003414124.1.46365 WP_003414124.1.46370 WP_003414124.1.46381 WP_003414124.1.46411 WP_003414124.1.4644 WP_003414124.1.46442 WP_003414124.1.46453 WP_003414124.1.46463 WP_003414124.1.46478 WP_003414124.1.46492 WP_003414124.1.46521 WP_003414124.1.4653 WP_003414124.1.46532 WP_003414124.1.46539 WP_003414124.1.46568 WP_003414124.1.46585 WP_003414124.1.46609 WP_003414124.1.46625 WP_003414124.1.46642 WP_003414124.1.46647 WP_003414124.1.46674 WP_003414124.1.46724 WP_003414124.1.46758 WP_003414124.1.46773 WP_003414124.1.46777 WP_003414124.1.46786 WP_003414124.1.46792 WP_003414124.1.46847 WP_003414124.1.46851 WP_003414124.1.4687 WP_003414124.1.46897 WP_003414124.1.46936 WP_003414124.1.46980 WP_003414124.1.47011 WP_003414124.1.47066 WP_003414124.1.47077 WP_003414124.1.47083 WP_003414124.1.47106 WP_003414124.1.47142 WP_003414124.1.47147 WP_003414124.1.47166 WP_003414124.1.47178 WP_003414124.1.47179 WP_003414124.1.47194 WP_003414124.1.47207 WP_003414124.1.47210 WP_003414124.1.47261 WP_003414124.1.47262 WP_003414124.1.47402 WP_003414124.1.47423 WP_003414124.1.47467 WP_003414124.1.47502 WP_003414124.1.4751 WP_003414124.1.47511 WP_003414124.1.47537 WP_003414124.1.47540 WP_003414124.1.47568 WP_003414124.1.47572 WP_003414124.1.47588 WP_003414124.1.47636 WP_003414124.1.4764 WP_003414124.1.47679 WP_003414124.1.47690 WP_003414124.1.4771 WP_003414124.1.47717 WP_003414124.1.47743 WP_003414124.1.47754 WP_003414124.1.47773 WP_003414124.1.47776 WP_003414124.1.47780 WP_003414124.1.47805 WP_003414124.1.47847 WP_003414124.1.47858 WP_003414124.1.47861 WP_003414124.1.47868 WP_003414124.1.47893 WP_003414124.1.47899 WP_003414124.1.479 WP_003414124.1.47912 WP_003414124.1.47913 WP_003414124.1.47926 WP_003414124.1.4794 WP_003414124.1.47944 WP_003414124.1.47959 WP_003414124.1.47974 WP_003414124.1.47993 WP_003414124.1.48004 WP_003414124.1.48039 WP_003414124.1.48084 WP_003414124.1.48097 WP_003414124.1.48101 WP_003414124.1.48109 WP_003414124.1.4813 WP_003414124.1.48130 WP_003414124.1.48135 WP_003414124.1.48143 WP_003414124.1.48152 WP_003414124.1.48155 WP_003414124.1.48170 WP_003414124.1.48173 WP_003414124.1.48177 WP_003414124.1.48185 WP_003414124.1.48204 WP_003414124.1.48219 WP_003414124.1.4823 WP_003414124.1.48240 WP_003414124.1.48256 WP_003414124.1.48264 WP_003414124.1.48287 WP_003414124.1.48330 WP_003414124.1.48333 WP_003414124.1.48348 WP_003414124.1.48354 WP_003414124.1.48372 WP_003414124.1.48383 WP_003414124.1.48388 WP_003414124.1.48419 WP_003414124.1.48423 WP_003414124.1.48443 WP_003414124.1.48462 WP_003414124.1.48543 WP_003414124.1.48550 WP_003414124.1.48605 WP_003414124.1.48618 WP_003414124.1.4863 WP_003414124.1.48648 WP_003414124.1.48658 WP_003414124.1.48666 WP_003414124.1.48687 WP_003414124.1.48779 WP_003414124.1.4878 WP_003414124.1.48798 WP_003414124.1.48802 WP_003414124.1.48826 WP_003414124.1.48831 WP_003414124.1.48843 WP_003414124.1.48857 WP_003414124.1.4890 WP_003414124.1.48946 WP_003414124.1.48979 WP_003414124.1.49017 WP_003414124.1.49048 WP_003414124.1.49059 WP_003414124.1.4906 WP_003414124.1.4907 WP_003414124.1.49103 WP_003414124.1.49110 WP_003414124.1.49111 WP_003414124.1.49112 WP_003414124.1.4919 WP_003414124.1.49251 WP_003414124.1.49254 WP_003414124.1.49263 WP_003414124.1.49291 WP_003414124.1.49296 WP_003414124.1.49335 WP_003414124.1.49337 WP_003414124.1.49419 WP_003414124.1.49426 WP_003414124.1.49437 WP_003414124.1.49439 WP_003414124.1.49474 WP_003414124.1.49506 WP_003414124.1.49516 WP_003414124.1.49523 WP_003414124.1.49526 WP_003414124.1.49532 WP_003414124.1.4959 WP_003414124.1.49678 WP_003414124.1.49687 WP_003414124.1.49699 WP_003414124.1.4971 WP_003414124.1.4972 WP_003414124.1.49736 WP_003414124.1.49746 WP_003414124.1.49764 WP_003414124.1.49773 WP_003414124.1.49796 WP_003414124.1.49814 WP_003414124.1.49815 WP_003414124.1.49816 WP_003414124.1.49839 WP_003414124.1.49857 WP_003414124.1.49878 WP_003414124.1.49880 WP_003414124.1.49944 WP_003414124.1.4999 WP_003414124.1.49990 WP_003414124.1.50068 WP_003414124.1.50077 WP_003414124.1.5008 WP_003414124.1.50081 WP_003414124.1.50122 WP_003414124.1.50126 WP_003414124.1.50149 WP_003414124.1.50162 WP_003414124.1.5018 WP_003414124.1.50194 WP_003414124.1.50235 WP_003414124.1.50249 WP_003414124.1.50265 WP_003414124.1.50271 WP_003414124.1.50324 WP_003414124.1.50347 WP_003414124.1.50372 WP_003414124.1.50398 WP_003414124.1.50407 WP_003414124.1.50444 WP_003414124.1.50466 WP_003414124.1.50472 WP_003414124.1.5048 WP_003414124.1.50498 WP_003414124.1.5050 WP_003414124.1.50540 WP_003414124.1.50554 WP_003414124.1.50557 WP_003414124.1.50601 WP_003414124.1.50610 WP_003414124.1.50632 WP_003414124.1.50633 WP_003414124.1.50642 WP_003414124.1.50655 WP_003414124.1.50659 WP_003414124.1.50683 WP_003414124.1.50689 WP_003414124.1.50692 WP_003414124.1.50714 WP_003414124.1.50729 WP_003414124.1.50756 WP_003414124.1.50784 WP_003414124.1.50794 WP_003414124.1.50841 WP_003414124.1.50860 WP_003414124.1.50868 WP_003414124.1.50877 WP_003414124.1.5096 WP_003414124.1.50981 WP_003414124.1.50987 WP_003414124.1.51003 WP_003414124.1.51009 WP_003414124.1.51037 WP_003414124.1.51074 WP_003414124.1.51082 WP_003414124.1.51101 WP_003414124.1.51116 WP_003414124.1.51149 WP_003414124.1.51156 WP_003414124.1.51157 WP_003414124.1.51213 WP_003414124.1.51232 WP_003414124.1.51239 WP_003414124.1.51247 WP_003414124.1.51266 WP_003414124.1.51279 WP_003414124.1.51291 WP_003414124.1.51294 WP_003414124.1.51301 WP_003414124.1.51329 WP_003414124.1.51391 WP_003414124.1.51422 WP_003414124.1.51445 WP_003414124.1.51455 WP_003414124.1.51466 WP_003414124.1.51468 WP_003414124.1.51478 WP_003414124.1.51497 WP_003414124.1.51520 WP_003414124.1.51593 WP_003414124.1.51628 WP_003414124.1.5164 WP_003414124.1.51647 WP_003414124.1.51660 WP_003414124.1.51696 WP_003414124.1.51721 WP_003414124.1.51788 WP_003414124.1.51795 WP_003414124.1.51801 WP_003414124.1.51817 WP_003414124.1.51819 WP_003414124.1.51854 WP_003414124.1.51923 WP_003414124.1.51942 WP_003414124.1.51948 WP_003414124.1.51963 WP_003414124.1.51969 WP_003414124.1.52000 WP_003414124.1.52001 WP_003414124.1.52003 WP_003414124.1.52006 WP_003414124.1.52046 WP_003414124.1.52059 WP_003414124.1.52069 WP_003414124.1.52082 WP_003414124.1.52102 WP_003414124.1.52106 WP_003414124.1.52166 WP_003414124.1.52168 WP_003414124.1.52178 WP_003414124.1.52206 WP_003414124.1.52216 WP_003414124.1.52238 WP_003414124.1.52241 WP_003414124.1.52280 WP_003414124.1.52314 WP_003414124.1.52385 WP_003414124.1.524 WP_003414124.1.52460 WP_003414124.1.52485 WP_003414124.1.52486 WP_003414124.1.52495 WP_003414124.1.52504 WP_003414124.1.52522 WP_003414124.1.52531 WP_003414124.1.52533 WP_003414124.1.52545 WP_003414124.1.52553 WP_003414124.1.52563 WP_003414124.1.52564 WP_003414124.1.52574 WP_003414124.1.52641 WP_003414124.1.52673 WP_003414124.1.52674 WP_003414124.1.52708 WP_003414124.1.52713 WP_003414124.1.52761 WP_003414124.1.52778 WP_003414124.1.52797 WP_003414124.1.52872 WP_003414124.1.52873 WP_003414124.1.52891 WP_003414124.1.52892 WP_003414124.1.52909 WP_003414124.1.52970 WP_003414124.1.52998 WP_003414124.1.53053 WP_003414124.1.53056 WP_003414124.1.5306 WP_003414124.1.53088 WP_003414124.1.5309 WP_003414124.1.531 WP_003414124.1.53118 WP_003414124.1.53142 WP_003414124.1.53143 WP_003414124.1.53157 WP_003414124.1.53167 WP_003414124.1.53200 WP_003414124.1.53213 WP_003414124.1.53217 WP_003414124.1.53226 WP_003414124.1.53229 WP_003414124.1.53230 WP_003414124.1.53237 WP_003414124.1.53254 WP_003414124.1.53257 WP_003414124.1.5327 WP_003414124.1.53276 WP_003414124.1.53278 WP_003414124.1.533 WP_003414124.1.53306 WP_003414124.1.5334 WP_003414124.1.5335 WP_003414124.1.53353 WP_003414124.1.53381 WP_003414124.1.53413 WP_003414124.1.53458 WP_003414124.1.53460 WP_003414124.1.53517 WP_003414124.1.53522 WP_003414124.1.53525 WP_003414124.1.53526 WP_003414124.1.53553 WP_003414124.1.53606 WP_003414124.1.53628 WP_003414124.1.53643 WP_003414124.1.53667 WP_003414124.1.53679 WP_003414124.1.53715 WP_003414124.1.53730 WP_003414124.1.53742 WP_003414124.1.53754 WP_003414124.1.53775 WP_003414124.1.53787 WP_003414124.1.53803 WP_003414124.1.53818 WP_003414124.1.53822 WP_003414124.1.53853 WP_003414124.1.53865 WP_003414124.1.53888 WP_003414124.1.53900 WP_003414124.1.53912 WP_003414124.1.53914 WP_003414124.1.53952 WP_003414124.1.5398 WP_003414124.1.5408 WP_003414124.1.54089 WP_003414124.1.54093 WP_003414124.1.54099 WP_003414124.1.54125 WP_003414124.1.54141 WP_003414124.1.54162 WP_003414124.1.54179 WP_003414124.1.54218 WP_003414124.1.54225 WP_003414124.1.54227 WP_003414124.1.54241 WP_003414124.1.54245 WP_003414124.1.54247 WP_003414124.1.54260 WP_003414124.1.54275 WP_003414124.1.54280 WP_003414124.1.5429 WP_003414124.1.54294 WP_003414124.1.54314 WP_003414124.1.54351 WP_003414124.1.54428 WP_003414124.1.54449 WP_003414124.1.54494 WP_003414124.1.54502 WP_003414124.1.54514 WP_003414124.1.54519 WP_003414124.1.5452 WP_003414124.1.54531 WP_003414124.1.54537 WP_003414124.1.54553 WP_003414124.1.54555 WP_003414124.1.54575 WP_003414124.1.54633 WP_003414124.1.54686 WP_003414124.1.54687 WP_003414124.1.54705 WP_003414124.1.54730 WP_003414124.1.54732 WP_003414124.1.5475 WP_003414124.1.54807 WP_003414124.1.54836 WP_003414124.1.54838 WP_003414124.1.54860 WP_003414124.1.54888 WP_003414124.1.54905 WP_003414124.1.54909 WP_003414124.1.54937 WP_003414124.1.54939 WP_003414124.1.54944 WP_003414124.1.54945 WP_003414124.1.54953 WP_003414124.1.54964 WP_003414124.1.55015 WP_003414124.1.55022 WP_003414124.1.55023 WP_003414124.1.55051 WP_003414124.1.55072 WP_003414124.1.55088 WP_003414124.1.55106 WP_003414124.1.55126 WP_003414124.1.55128 WP_003414124.1.55140 WP_003414124.1.55150 WP_003414124.1.55210 WP_003414124.1.55227 WP_003414124.1.55248 WP_003414124.1.55257 WP_003414124.1.55258 WP_003414124.1.55267 WP_003414124.1.55279 WP_003414124.1.55307 WP_003414124.1.55326 WP_003414124.1.55328 WP_003414124.1.5533 WP_003414124.1.55345 WP_003414124.1.55396 WP_003414124.1.55398 WP_003414124.1.55441 WP_003414124.1.55459 WP_003414124.1.55501 WP_003414124.1.55504 WP_003414124.1.55578 WP_003414124.1.55626 WP_003414124.1.55641 WP_003414124.1.5569 WP_003414124.1.55723 WP_003414124.1.55735 WP_003414124.1.55772 WP_003414124.1.55802 WP_003414124.1.55807 WP_003414124.1.55821 WP_003414124.1.5583 WP_003414124.1.55849 WP_003414124.1.55856 WP_003414124.1.55882 WP_003414124.1.55883 WP_003414124.1.55894 WP_003414124.1.55902 WP_003414124.1.55908 WP_003414124.1.55909 WP_003414124.1.5591 WP_003414124.1.55961 WP_003414124.1.55977 WP_003414124.1.55983 WP_003414124.1.56028 WP_003414124.1.56057 WP_003414124.1.56060 WP_003414124.1.56107 WP_003414124.1.56132 WP_003414124.1.56163 WP_003414124.1.56167 WP_003414124.1.56178 WP_003414124.1.56287 WP_003414124.1.56292 WP_003414124.1.56327 WP_003414124.1.56341 WP_003414124.1.56359 WP_003414124.1.56365 WP_003414124.1.56394 WP_003414124.1.56443 WP_003414124.1.56473 WP_003414124.1.56478 WP_003414124.1.56500 WP_003414124.1.56517 WP_003414124.1.56534 WP_003414124.1.5656 WP_003414124.1.56577 WP_003414124.1.56593 WP_003414124.1.56625 WP_003414124.1.56637 WP_003414124.1.56670 WP_003414124.1.56697 WP_003414124.1.567 WP_003414124.1.56701 WP_003414124.1.56709 WP_003414124.1.56729 WP_003414124.1.56743 WP_003414124.1.56755 WP_003414124.1.56764 WP_003414124.1.56770 WP_003414124.1.56795 WP_003414124.1.5681 WP_003414124.1.56827 WP_003414124.1.56839 WP_003414124.1.56863 WP_003414124.1.56868 WP_003414124.1.56869 WP_003414124.1.56915 WP_003414124.1.56926 WP_003414124.1.56961 WP_003414124.1.56971 WP_003414124.1.56972 WP_003414124.1.57023 WP_003414124.1.57035 WP_003414124.1.57077 WP_003414124.1.57087 WP_003414124.1.57094 WP_003414124.1.57134 WP_003414124.1.57169 WP_003414124.1.57208 WP_003414124.1.57212 WP_003414124.1.57230 WP_003414124.1.5724 WP_003414124.1.5725 WP_003414124.1.5727 WP_003414124.1.57273 WP_003414124.1.573 WP_003414124.1.57314 WP_003414124.1.57326 WP_003414124.1.57328 WP_003414124.1.57331 WP_003414124.1.57352 WP_003414124.1.57380 WP_003414124.1.57430 WP_003414124.1.5744 WP_003414124.1.57440 WP_003414124.1.5745 WP_003414124.1.57461 WP_003414124.1.57469 WP_003414124.1.57489 WP_003414124.1.575 WP_003414124.1.57509 WP_003414124.1.57519 WP_003414124.1.57525 WP_003414124.1.57551 WP_003414124.1.5758 WP_003414124.1.57596 WP_003414124.1.57604 WP_003414124.1.57616 WP_003414124.1.57619 WP_003414124.1.57627 WP_003414124.1.57642 WP_003414124.1.57658 WP_003414124.1.57667 WP_003414124.1.57675 WP_003414124.1.57689 WP_003414124.1.57708 WP_003414124.1.57794 WP_003414124.1.57821 WP_003414124.1.57825 WP_003414124.1.57843 WP_003414124.1.57906 WP_003414124.1.57924 WP_003414124.1.57926 WP_003414124.1.57957 WP_003414124.1.57960 WP_003414124.1.57964 WP_003414124.1.57991 WP_003414124.1.58000 WP_003414124.1.58086 WP_003414124.1.58101 WP_003414124.1.58103 WP_003414124.1.58108 WP_003414124.1.5811 WP_003414124.1.58121 WP_003414124.1.58145 WP_003414124.1.58164 WP_003414124.1.58174 WP_003414124.1.582 WP_003414124.1.58209 WP_003414124.1.58215 WP_003414124.1.5824 WP_003414124.1.58250 WP_003414124.1.58259 WP_003414124.1.58283 WP_003414124.1.5830 WP_003414124.1.58303 WP_003414124.1.58311 WP_003414124.1.58330 WP_003414124.1.58359 WP_003414124.1.58386 WP_003414124.1.58393 WP_003414124.1.58431 WP_003414124.1.5844 WP_003414124.1.58488 WP_003414124.1.58518 WP_003414124.1.58534 WP_003414124.1.58559 WP_003414124.1.58567 WP_003414124.1.58573 WP_003414124.1.58602 WP_003414124.1.58612 WP_003414124.1.58619 WP_003414124.1.58630 WP_003414124.1.5865 WP_003414124.1.58671 WP_003414124.1.58690 WP_003414124.1.58702 WP_003414124.1.58743 WP_003414124.1.58754 WP_003414124.1.5879 WP_003414124.1.5881 WP_003414124.1.58824 WP_003414124.1.58848 WP_003414124.1.58857 WP_003414124.1.58891 WP_003414124.1.58892 WP_003414124.1.5890 WP_003414124.1.58904 WP_003414124.1.58921 WP_003414124.1.58930 WP_003414124.1.58953 WP_003414124.1.58961 WP_003414124.1.5898 WP_003414124.1.59025 WP_003414124.1.59029 WP_003414124.1.59037 WP_003414124.1.59085 WP_003414124.1.59088 WP_003414124.1.59112 WP_003414124.1.59130 WP_003414124.1.5914 WP_003414124.1.59147 WP_003414124.1.59166 WP_003414124.1.59205 WP_003414124.1.59209 WP_003414124.1.59237 WP_003414124.1.59240 WP_003414124.1.59253 WP_003414124.1.59254 WP_003414124.1.59262 WP_003414124.1.59270 WP_003414124.1.5928 WP_003414124.1.59304 WP_003414124.1.59305 WP_003414124.1.59309 WP_003414124.1.59326 WP_003414124.1.59328 WP_003414124.1.59333 WP_003414124.1.59338 WP_003414124.1.59388 WP_003414124.1.59487 WP_003414124.1.59537 WP_003414124.1.59561 WP_003414124.1.59677 WP_003414124.1.59722 WP_003414124.1.59727 WP_003414124.1.59732 WP_003414124.1.59738 WP_003414124.1.59750 WP_003414124.1.59757 WP_003414124.1.59761 WP_003414124.1.59808 WP_003414124.1.59850 WP_003414124.1.59860 WP_003414124.1.59861 WP_003414124.1.5987 WP_003414124.1.59878 WP_003414124.1.59888 WP_003414124.1.5996 WP_003414124.1.59961 WP_003414124.1.59974 WP_003414124.1.6000 WP_003414124.1.6003 WP_003414124.1.60047 WP_003414124.1.6007 WP_003414124.1.60121 WP_003414124.1.60125 WP_003414124.1.60139 WP_003414124.1.60152 WP_003414124.1.60171 WP_003414124.1.60197 WP_003414124.1.6020 WP_003414124.1.60205 WP_003414124.1.60207 WP_003414124.1.60215 WP_003414124.1.60217 WP_003414124.1.60267 WP_003414124.1.60288 WP_003414124.1.60301 WP_003414124.1.60305 WP_003414124.1.60312 WP_003414124.1.60313 WP_003414124.1.60314 WP_003414124.1.60367 WP_003414124.1.60376 WP_003414124.1.60403 WP_003414124.1.60413 WP_003414124.1.60421 WP_003414124.1.60451 WP_003414124.1.60460 WP_003414124.1.60512 WP_003414124.1.60573 WP_003414124.1.60583 WP_003414124.1.60632 WP_003414124.1.60657 WP_003414124.1.60687 WP_003414124.1.60689 WP_003414124.1.60727 WP_003414124.1.60738 WP_003414124.1.6077 WP_003414124.1.60791 WP_003414124.1.60834 WP_003414124.1.60870 WP_003414124.1.60878 WP_003414124.1.60879 WP_003414124.1.60913 WP_003414124.1.60978 WP_003414124.1.61000 WP_003414124.1.61001 WP_003414124.1.61012 WP_003414124.1.61014 WP_003414124.1.61015 WP_003414124.1.61037 WP_003414124.1.61052 WP_003414124.1.61065 WP_003414124.1.61100 WP_003414124.1.61101 WP_003414124.1.61138 WP_003414124.1.61142 WP_003414124.1.61198 WP_003414124.1.612 WP_003414124.1.61234 WP_003414124.1.61256 WP_003414124.1.61281 WP_003414124.1.61314 WP_003414124.1.61321 WP_003414124.1.61326 WP_003414124.1.61328 WP_003414124.1.61368 WP_003414124.1.61391 WP_003414124.1.61406 WP_003414124.1.61409 WP_003414124.1.61420 WP_003414124.1.61422 WP_003414124.1.61425 WP_003414124.1.61469 WP_003414124.1.61494 WP_003414124.1.61522 WP_003414124.1.61552 WP_003414124.1.61557 WP_003414124.1.61567 WP_003414124.1.61571 WP_003414124.1.61573 WP_003414124.1.61584 WP_003414124.1.61586 WP_003414124.1.6159 WP_003414124.1.61592 WP_003414124.1.6160 WP_003414124.1.61614 WP_003414124.1.6163 WP_003414124.1.61655 WP_003414124.1.61665 WP_003414124.1.61669 WP_003414124.1.61682 WP_003414124.1.61692 WP_003414124.1.61719 WP_003414124.1.61728 WP_003414124.1.61750 WP_003414124.1.61754 WP_003414124.1.61755 WP_003414124.1.61757 WP_003414124.1.61778 WP_003414124.1.6179 WP_003414124.1.61816 WP_003414124.1.61842 WP_003414124.1.61850 WP_003414124.1.61862 WP_003414124.1.61865 WP_003414124.1.61868 WP_003414124.1.61911 WP_003414124.1.61953 WP_003414124.1.61979 WP_003414124.1.61986 WP_003414124.1.61987 WP_003414124.1.61998 WP_003414124.1.62021 WP_003414124.1.62087 WP_003414124.1.62089 WP_003414124.1.62101 WP_003414124.1.62104 WP_003414124.1.62132 WP_003414124.1.62162 WP_003414124.1.62225 WP_003414124.1.62230 WP_003414124.1.62238 WP_003414124.1.62249 WP_003414124.1.62270 WP_003414124.1.62281 WP_003414124.1.62307 WP_003414124.1.6231 WP_003414124.1.62359 WP_003414124.1.62360 WP_003414124.1.62379 WP_003414124.1.62395 WP_003414124.1.62449 WP_003414124.1.62468 WP_003414124.1.6248 WP_003414124.1.62508 WP_003414124.1.62565 WP_003414124.1.62594 WP_003414124.1.62606 WP_003414124.1.62616 WP_003414124.1.62666 WP_003414124.1.62687 WP_003414124.1.62715 WP_003414124.1.62730 WP_003414124.1.62738 WP_003414124.1.62761 WP_003414124.1.62766 WP_003414124.1.62813 WP_003414124.1.62839 WP_003414124.1.62841 WP_003414124.1.62936 WP_003414124.1.6294 WP_003414124.1.6295 WP_003414124.1.63007 WP_003414124.1.63019 WP_003414124.1.63032 WP_003414124.1.63037 WP_003414124.1.63064 WP_003414124.1.63066 WP_003414124.1.63072 WP_003414124.1.6308 WP_003414124.1.63081 WP_003414124.1.63096 WP_003414124.1.63106 WP_003414124.1.6314 WP_003414124.1.63144 WP_003414124.1.63154 WP_003414124.1.63160 WP_003414124.1.63161 WP_003414124.1.63166 WP_003414124.1.63175 WP_003414124.1.63194 WP_003414124.1.63222 WP_003414124.1.63247 WP_003414124.1.6328 WP_003414124.1.63291 WP_003414124.1.63312 WP_003414124.1.63317 WP_003414124.1.63331 WP_003414124.1.63373 WP_003414124.1.63384 WP_003414124.1.63403 WP_003414124.1.63424 WP_003414124.1.63428 WP_003414124.1.6345 WP_003414124.1.63464 WP_003414124.1.63483 WP_003414124.1.63502 WP_003414124.1.63504 WP_003414124.1.63522 WP_003414124.1.63530 WP_003414124.1.63538 WP_003414124.1.63564 WP_003414124.1.63567 WP_003414124.1.63596 WP_003414124.1.63600 WP_003414124.1.63623 WP_003414124.1.63624 WP_003414124.1.63625 WP_003414124.1.63627 WP_003414124.1.63654 WP_003414124.1.63662 WP_003414124.1.63711 WP_003414124.1.63734 WP_003414124.1.63807 WP_003414124.1.63819 WP_003414124.1.63844 WP_003414124.1.63888 WP_003414124.1.63913 WP_003414124.1.63915 WP_003414124.1.63961 WP_003414124.1.63970 WP_003414124.1.64000 WP_003414124.1.64027 WP_003414124.1.64058 WP_003414124.1.64065 WP_003414124.1.6407 WP_003414124.1.64082 WP_003414124.1.64091 WP_003414124.1.64102 WP_003414124.1.64104 WP_003414124.1.64169 WP_003414124.1.64219 WP_003414124.1.6422 WP_003414124.1.64222 WP_003414124.1.64223 WP_003414124.1.64228 WP_003414124.1.64235 WP_003414124.1.64249 WP_003414124.1.6427 WP_003414124.1.64278 WP_003414124.1.64287 WP_003414124.1.64414 WP_003414124.1.6443 WP_003414124.1.64463 WP_003414124.1.64480 WP_003414124.1.64497 WP_003414124.1.64506 WP_003414124.1.64511 WP_003414124.1.64513 WP_003414124.1.64514 WP_003414124.1.64515 WP_003414124.1.64522 WP_003414124.1.64543 WP_003414124.1.6456 WP_003414124.1.64567 WP_003414124.1.64588 WP_003414124.1.64589 WP_003414124.1.64594 WP_003414124.1.64595 WP_003414124.1.64608 WP_003414124.1.64619 WP_003414124.1.64629 WP_003414124.1.6464 WP_003414124.1.64664 WP_003414124.1.64669 WP_003414124.1.64672 WP_003414124.1.64680 WP_003414124.1.64682 WP_003414124.1.64727 WP_003414124.1.64729 WP_003414124.1.64776 WP_003414124.1.64832 WP_003414124.1.6486 WP_003414124.1.64870 WP_003414124.1.64898 WP_003414124.1.64922 WP_003414124.1.64924 WP_003414124.1.6493 WP_003414124.1.64941 WP_003414124.1.64966 WP_003414124.1.65001 WP_003414124.1.65026 WP_003414124.1.65053 WP_003414124.1.65070 WP_003414124.1.65079 WP_003414124.1.65102 WP_003414124.1.65157 WP_003414124.1.65181 WP_003414124.1.65212 WP_003414124.1.65229 WP_003414124.1.6523 WP_003414124.1.65253 WP_003414124.1.65289 WP_003414124.1.65291 WP_003414124.1.65315 WP_003414124.1.65329 WP_003414124.1.65359 WP_003414124.1.6536 WP_003414124.1.65374 WP_003414124.1.65414 WP_003414124.1.65416 WP_003414124.1.65433 WP_003414124.1.65455 WP_003414124.1.65467 WP_003414124.1.65529 WP_003414124.1.65539 WP_003414124.1.65583 WP_003414124.1.65612 WP_003414124.1.65623 WP_003414124.1.65635 WP_003414124.1.65637 WP_003414124.1.65648 WP_003414124.1.65683 WP_003414124.1.65686 WP_003414124.1.65688 WP_003414124.1.65733 WP_003414124.1.65746 WP_003414124.1.65747 WP_003414124.1.65759 WP_003414124.1.65816 WP_003414124.1.65830 WP_003414124.1.65858 WP_003414124.1.65862 WP_003414124.1.65869 WP_003414124.1.65893 WP_003414124.1.65929 WP_003414124.1.65932 WP_003414124.1.65958 WP_003414124.1.65974 WP_003414124.1.66004 WP_003414124.1.66013 WP_003414124.1.6606 WP_003414124.1.66089 WP_003414124.1.66149 WP_003414124.1.66151 WP_003414124.1.66276 WP_003414124.1.66293 WP_003414124.1.66297 WP_003414124.1.66323 WP_003414124.1.66325 WP_003414124.1.6633 WP_003414124.1.66334 WP_003414124.1.66355 WP_003414124.1.66367 WP_003414124.1.66394 WP_003414124.1.66396 WP_003414124.1.66451 WP_003414124.1.66455 WP_003414124.1.66457 WP_003414124.1.66464 WP_003414124.1.66466 WP_003414124.1.66487 WP_003414124.1.66504 WP_003414124.1.66544 WP_003414124.1.66558 WP_003414124.1.66580 WP_003414124.1.66582 WP_003414124.1.66612 WP_003414124.1.66617 WP_003414124.1.66635 WP_003414124.1.66656 WP_003414124.1.66663 WP_003414124.1.66675 WP_003414124.1.66715 WP_003414124.1.66718 WP_003414124.1.66762 WP_003414124.1.66776 WP_003414124.1.66808 WP_003414124.1.66817 WP_003414124.1.66819 WP_003414124.1.66826 WP_003414124.1.66830 WP_003414124.1.66842 WP_003414124.1.66868 WP_003414124.1.66878 WP_003414124.1.66880 WP_003414124.1.66893 WP_003414124.1.66961 WP_003414124.1.67005 WP_003414124.1.6704 WP_003414124.1.67044 WP_003414124.1.67061 WP_003414124.1.67089 WP_003414124.1.67098 WP_003414124.1.67146 WP_003414124.1.67170 WP_003414124.1.67197 WP_003414124.1.67198 WP_003414124.1.6720 WP_003414124.1.67207 WP_003414124.1.67218 WP_003414124.1.67220 WP_003414124.1.67225 WP_003414124.1.67231 WP_003414124.1.6724 WP_003414124.1.67257 WP_003414124.1.67298 WP_003414124.1.67307 WP_003414124.1.67332 WP_003414124.1.67346 WP_003414124.1.67360 WP_003414124.1.67381 WP_003414124.1.67396 WP_003414124.1.67417 WP_003414124.1.67422 WP_003414124.1.67453 WP_003414124.1.67459 WP_003414124.1.6746 WP_003414124.1.67473 WP_003414124.1.67482 WP_003414124.1.67496 WP_003414124.1.67499 WP_003414124.1.67523 WP_003414124.1.67536 WP_003414124.1.67575 WP_003414124.1.67587 WP_003414124.1.67598 WP_003414124.1.67600 WP_003414124.1.67602 WP_003414124.1.67630 WP_003414124.1.67679 WP_003414124.1.67692 WP_003414124.1.67744 WP_003414124.1.6775 WP_003414124.1.67750 WP_003414124.1.6777 WP_003414124.1.67809 WP_003414124.1.67816 WP_003414124.1.67844 WP_003414124.1.67848 WP_003414124.1.67870 WP_003414124.1.67888 WP_003414124.1.67915 WP_003414124.1.67945 WP_003414124.1.67949 WP_003414124.1.67980 WP_003414124.1.67982 WP_003414124.1.68022 WP_003414124.1.68029 WP_003414124.1.68037 WP_003414124.1.68038 WP_003414124.1.68045 WP_003414124.1.68057 WP_003414124.1.68083 WP_003414124.1.68088 WP_003414124.1.68106 WP_003414124.1.68110 WP_003414124.1.68153 WP_003414124.1.68164 WP_003414124.1.68169 WP_003414124.1.68193 WP_003414124.1.68212 WP_003414124.1.68227 WP_003414124.1.68243 WP_003414124.1.6825 WP_003414124.1.68297 WP_003414124.1.68309 WP_003414124.1.68325 WP_003414124.1.68329 WP_003414124.1.68340 WP_003414124.1.68384 WP_003414124.1.68388 WP_003414124.1.68429 WP_003414124.1.6843 WP_003414124.1.68433 WP_003414124.1.68444 WP_003414124.1.68465 WP_003414124.1.68484 WP_003414124.1.68518 WP_003414124.1.68569 WP_003414124.1.68576 WP_003414124.1.68586 WP_003414124.1.68623 WP_003414124.1.68624 WP_003414124.1.68637 WP_003414124.1.68646 WP_003414124.1.68669 WP_003414124.1.68672 WP_003414124.1.68684 WP_003414124.1.68704 WP_003414124.1.68708 WP_003414124.1.6872 WP_003414124.1.68730 WP_003414124.1.68734 WP_003414124.1.68748 WP_003414124.1.68754 WP_003414124.1.6876 WP_003414124.1.68761 WP_003414124.1.68763 WP_003414124.1.68766 WP_003414124.1.68774 WP_003414124.1.68796 WP_003414124.1.68824 WP_003414124.1.68832 WP_003414124.1.68833 WP_003414124.1.68841 WP_003414124.1.68859 WP_003414124.1.68876 WP_003414124.1.68906 WP_003414124.1.68916 WP_003414124.1.68923 WP_003414124.1.68945 WP_003414124.1.6896 WP_003414124.1.68981 WP_003414124.1.68984 WP_003414124.1.68997 WP_003414124.1.69076 WP_003414124.1.69079 WP_003414124.1.6908 WP_003414124.1.69082 WP_003414124.1.69178 WP_003414124.1.69181 WP_003414124.1.69208 WP_003414124.1.69231 WP_003414124.1.69256 WP_003414124.1.69311 WP_003414124.1.69315 WP_003414124.1.69342 WP_003414124.1.6936 WP_003414124.1.69369 WP_003414124.1.69374 WP_003414124.1.69398 WP_003414124.1.69401 WP_003414124.1.69426 WP_003414124.1.69427 WP_003414124.1.69429 WP_003414124.1.6949 WP_003414124.1.6951 WP_003414124.1.69511 WP_003414124.1.69526 WP_003414124.1.69528 WP_003414124.1.69547 WP_003414124.1.69573 WP_003414124.1.69581 WP_003414124.1.6960 WP_003414124.1.69617 WP_003414124.1.69634 WP_003414124.1.69647 WP_003414124.1.69659 WP_003414124.1.69673 WP_003414124.1.69682 WP_003414124.1.69684 WP_003414124.1.69686 WP_003414124.1.69707 WP_003414124.1.69709 WP_003414124.1.69723 WP_003414124.1.69736 WP_003414124.1.69778 WP_003414124.1.69800 WP_003414124.1.69802 WP_003414124.1.69845 WP_003414124.1.69870 WP_003414124.1.69873 WP_003414124.1.69898 WP_003414124.1.69913 WP_003414124.1.69925 WP_003414124.1.69931 WP_003414124.1.69938 WP_003414124.1.69955 WP_003414124.1.69957 WP_003414124.1.69981 WP_003414124.1.69990 WP_003414124.1.70 WP_003414124.1.70000 WP_003414124.1.70017 WP_003414124.1.70032 WP_003414124.1.70055 WP_003414124.1.70062 WP_003414124.1.70072 WP_003414124.1.70132 WP_003414124.1.7022 WP_003414124.1.70227 WP_003414124.1.70255 WP_003414124.1.70271 WP_003414124.1.70274 WP_003414124.1.7029 WP_003414124.1.70325 WP_003414124.1.70328 WP_003414124.1.70356 WP_003414124.1.70364 WP_003414124.1.70368 WP_003414124.1.70418 WP_003414124.1.70422 WP_003414124.1.70435 WP_003414124.1.70444 WP_003414124.1.70463 WP_003414124.1.70471 WP_003414124.1.70480 WP_003414124.1.70494 WP_003414124.1.70498 WP_003414124.1.70525 WP_003414124.1.70573 WP_003414124.1.70577 WP_003414124.1.70610 WP_003414124.1.70615 WP_003414124.1.70618 WP_003414124.1.70622 WP_003414124.1.70626 WP_003414124.1.70668 WP_003414124.1.70699 WP_003414124.1.70704 WP_003414124.1.70729 WP_003414124.1.70757 WP_003414124.1.70782 WP_003414124.1.70796 WP_003414124.1.70834 WP_003414124.1.7084 WP_003414124.1.70840 WP_003414124.1.70864 WP_003414124.1.70871 WP_003414124.1.70915 WP_003414124.1.70955 WP_003414124.1.70958 WP_003414124.1.70964 WP_003414124.1.70976 WP_003414124.1.71015 WP_003414124.1.71063 WP_003414124.1.71076 WP_003414124.1.71083 WP_003414124.1.7111 WP_003414124.1.71118 WP_003414124.1.7113 WP_003414124.1.71187 WP_003414124.1.71191 WP_003414124.1.71255 WP_003414124.1.71258 WP_003414124.1.71259 WP_003414124.1.71289 WP_003414124.1.71326 WP_003414124.1.71329 WP_003414124.1.71331 WP_003414124.1.71344 WP_003414124.1.71390 WP_003414124.1.71440 WP_003414124.1.71457 WP_003414124.1.71464 WP_003414124.1.71490 WP_003414124.1.71492 WP_003414124.1.71509 WP_003414124.1.71516 WP_003414124.1.71517 WP_003414124.1.71527 WP_003414124.1.71545 WP_003414124.1.71546 WP_003414124.1.71569 WP_003414124.1.71604 WP_003414124.1.71621 WP_003414124.1.71630 WP_003414124.1.71638 WP_003414124.1.71654 WP_003414124.1.71664 WP_003414124.1.71665 WP_003414124.1.71683 WP_003414124.1.71701 WP_003414124.1.71718 WP_003414124.1.71731 WP_003414124.1.71778 WP_003414124.1.71781 WP_003414124.1.71803 WP_003414124.1.71820 WP_003414124.1.71847 WP_003414124.1.7185 WP_003414124.1.71871 WP_003414124.1.71909 WP_003414124.1.71957 WP_003414124.1.71970 WP_003414124.1.72047 WP_003414124.1.72061 WP_003414124.1.72062 WP_003414124.1.72072 WP_003414124.1.72111 WP_003414124.1.72122 WP_003414124.1.72128 WP_003414124.1.72143 WP_003414124.1.72168 WP_003414124.1.72179 WP_003414124.1.72209 WP_003414124.1.72218 WP_003414124.1.72219 WP_003414124.1.72227 WP_003414124.1.7224 WP_003414124.1.72268 WP_003414124.1.72332 WP_003414124.1.72380 WP_003414124.1.72401 WP_003414124.1.72405 WP_003414124.1.72420 WP_003414124.1.72441 WP_003414124.1.72451 WP_003414124.1.72452 WP_003414124.1.72457 WP_003414124.1.72459 WP_003414124.1.72460 WP_003414124.1.72466 WP_003414124.1.72487 WP_003414124.1.72488 WP_003414124.1.72492 WP_003414124.1.72506 WP_003414124.1.72543 WP_003414124.1.7256 WP_003414124.1.72576 WP_003414124.1.72585 WP_003414124.1.72591 WP_003414124.1.72592 WP_003414124.1.72640 WP_003414124.1.7266 WP_003414124.1.72661 WP_003414124.1.72684 WP_003414124.1.72739 WP_003414124.1.72744 WP_003414124.1.72755 WP_003414124.1.72759 WP_003414124.1.72784 WP_003414124.1.72792 WP_003414124.1.72826 WP_003414124.1.72831 WP_003414124.1.72852 WP_003414124.1.72853 WP_003414124.1.72879 WP_003414124.1.72938 WP_003414124.1.72954 WP_003414124.1.72957 WP_003414124.1.72959 WP_003414124.1.72973 WP_003414124.1.72982 WP_003414124.1.72988 WP_003414124.1.72993 WP_003414124.1.73006 WP_003414124.1.73013 WP_003414124.1.73025 WP_003414124.1.73028 WP_003414124.1.73042 WP_003414124.1.73045 WP_003414124.1.73092 WP_003414124.1.73118 WP_003414124.1.7312 WP_003414124.1.73127 WP_003414124.1.73134 WP_003414124.1.73154 WP_003414124.1.73163 WP_003414124.1.73182 WP_003414124.1.73205 WP_003414124.1.7321 WP_003414124.1.73310 WP_003414124.1.73365 WP_003414124.1.73391 WP_003414124.1.73404 WP_003414124.1.73424 WP_003414124.1.73445 WP_003414124.1.73453 WP_003414124.1.73465 WP_003414124.1.73470 WP_003414124.1.73471 WP_003414124.1.73478 WP_003414124.1.73482 WP_003414124.1.73507 WP_003414124.1.73532 WP_003414124.1.73550 WP_003414124.1.73564 WP_003414124.1.73623 WP_003414124.1.73629 WP_003414124.1.73644 WP_003414124.1.7366 WP_003414124.1.73661 WP_003414124.1.7368 WP_003414124.1.73688 WP_003414124.1.73723 WP_003414124.1.73744 WP_003414124.1.73750 WP_003414124.1.73760 WP_003414124.1.73774 WP_003414124.1.7379 WP_003414124.1.73813 WP_003414124.1.73840 WP_003414124.1.73876 WP_003414124.1.7389 WP_003414124.1.73986 WP_003414124.1.74016 WP_003414124.1.74039 WP_003414124.1.74083 WP_003414124.1.74101 WP_003414124.1.74107 WP_003414124.1.74129 WP_003414124.1.74144 WP_003414124.1.7417 WP_003414124.1.74190 WP_003414124.1.74210 WP_003414124.1.7423 WP_003414124.1.74259 WP_003414124.1.74262 WP_003414124.1.74269 WP_003414124.1.74282 WP_003414124.1.74291 WP_003414124.1.74296 WP_003414124.1.74304 WP_003414124.1.7432 WP_003414124.1.74347 WP_003414124.1.7436 WP_003414124.1.74378 WP_003414124.1.74382 WP_003414124.1.74395 WP_003414124.1.74400 WP_003414124.1.74432 WP_003414124.1.74442 WP_003414124.1.74477 WP_003414124.1.74487 WP_003414124.1.74499 WP_003414124.1.74504 WP_003414124.1.74511 WP_003414124.1.74523 WP_003414124.1.74525 WP_003414124.1.74551 WP_003414124.1.74555 WP_003414124.1.74628 WP_003414124.1.74641 WP_003414124.1.74653 WP_003414124.1.74660 WP_003414124.1.74683 WP_003414124.1.7469 WP_003414124.1.74725 WP_003414124.1.74760 WP_003414124.1.74786 WP_003414124.1.74820 WP_003414124.1.74870 WP_003414124.1.74881 WP_003414124.1.74888 WP_003414124.1.74952 WP_003414124.1.7496 WP_003414124.1.74988 WP_003414124.1.75043 WP_003414124.1.75055 WP_003414124.1.75078 WP_003414124.1.75081 WP_003414124.1.75120 WP_003414124.1.75163 WP_003414124.1.75188 WP_003414124.1.75200 WP_003414124.1.75202 WP_003414124.1.75239 WP_003414124.1.75263 WP_003414124.1.75342 WP_003414124.1.7535 WP_003414124.1.75376 WP_003414124.1.75391 WP_003414124.1.75395 WP_003414124.1.75441 WP_003414124.1.75510 WP_003414124.1.75581 WP_003414124.1.75598 WP_003414124.1.75635 WP_003414124.1.75645 WP_003414124.1.75665 WP_003414124.1.75671 WP_003414124.1.75741 WP_003414124.1.75749 WP_003414124.1.75772 WP_003414124.1.75774 WP_003414124.1.75811 WP_003414124.1.75833 WP_003414124.1.7585 WP_003414124.1.75864 WP_003414124.1.75868 WP_003414124.1.75878 WP_003414124.1.75927 WP_003414124.1.75946 WP_003414124.1.75968 WP_003414124.1.75974 WP_003414124.1.76007 WP_003414124.1.76016 WP_003414124.1.76032 WP_003414124.1.76037 WP_003414124.1.7604 WP_003414124.1.76045 WP_003414124.1.76052 WP_003414124.1.76058 WP_003414124.1.76064 WP_003414124.1.76110 WP_003414124.1.76126 WP_003414124.1.76138 WP_003414124.1.76157 WP_003414124.1.76172 WP_003414124.1.76177 WP_003414124.1.76183 WP_003414124.1.76209 WP_003414124.1.76239 WP_003414124.1.76272 WP_003414124.1.76277 WP_003414124.1.76280 WP_003414124.1.76281 WP_003414124.1.76291 WP_003414124.1.76297 WP_003414124.1.76360 WP_003414124.1.76379 WP_003414124.1.76403 WP_003414124.1.76413 WP_003414124.1.76414 WP_003414124.1.76436 WP_003414124.1.76442 WP_003414124.1.76443 WP_003414124.1.76456 WP_003414124.1.76521 WP_003414124.1.76533 WP_003414124.1.76616 WP_003414124.1.76625 WP_003414124.1.76629 WP_003414124.1.76635 WP_003414124.1.76638 WP_003414124.1.76639 WP_003414124.1.76640 WP_003414124.1.76644 WP_003414124.1.76677 WP_003414124.1.76678 WP_003414124.1.76679 WP_003414124.1.76734 WP_003414124.1.76744 WP_003414124.1.76750 WP_003414124.1.76754 WP_003414124.1.76757 WP_003414124.1.76818 WP_003414124.1.76824 WP_003414124.1.76835 WP_003414124.1.76873 WP_003414124.1.76881 WP_003414124.1.76888 WP_003414124.1.76900 WP_003414124.1.7691 WP_003414124.1.76947 WP_003414124.1.76954 WP_003414124.1.76955 WP_003414124.1.76963 WP_003414124.1.76976 WP_003414124.1.770 WP_003414124.1.77008 WP_003414124.1.77021 WP_003414124.1.77056 WP_003414124.1.77065 WP_003414124.1.77075 WP_003414124.1.77093 WP_003414124.1.77115 WP_003414124.1.77118 WP_003414124.1.77125 WP_003414124.1.77141 WP_003414124.1.77142 WP_003414124.1.77166 WP_003414124.1.77250 WP_003414124.1.77260 WP_003414124.1.77266 WP_003414124.1.77285 WP_003414124.1.77312 WP_003414124.1.77348 WP_003414124.1.77351 WP_003414124.1.77352 WP_003414124.1.77361 WP_003414124.1.774 WP_003414124.1.77404 WP_003414124.1.77425 WP_003414124.1.77463 WP_003414124.1.77474 WP_003414124.1.7748 WP_003414124.1.77491 WP_003414124.1.77499 WP_003414124.1.77510 WP_003414124.1.77530 WP_003414124.1.77554 WP_003414124.1.77559 WP_003414124.1.77599 WP_003414124.1.7762 WP_003414124.1.77627 WP_003414124.1.77649 WP_003414124.1.77654 WP_003414124.1.7766 WP_003414124.1.77667 WP_003414124.1.77704 WP_003414124.1.77706 WP_003414124.1.77726 WP_003414124.1.7778 WP_003414124.1.77790 WP_003414124.1.77809 WP_003414124.1.77820 WP_003414124.1.77843 WP_003414124.1.77855 WP_003414124.1.77865 WP_003414124.1.77868 WP_003414124.1.77879 WP_003414124.1.77890 WP_003414124.1.77909 WP_003414124.1.77911 WP_003414124.1.77931 WP_003414124.1.77984 WP_003414124.1.78020 WP_003414124.1.78024 WP_003414124.1.78075 WP_003414124.1.78084 WP_003414124.1.78086 WP_003414124.1.7809 WP_003414124.1.78098 WP_003414124.1.78105 WP_003414124.1.78113 WP_003414124.1.78136 WP_003414124.1.78162 WP_003414124.1.7817 WP_003414124.1.78200 WP_003414124.1.78216 WP_003414124.1.78236 WP_003414124.1.78238 WP_003414124.1.78322 WP_003414124.1.78338 WP_003414124.1.7836 WP_003414124.1.78360 WP_003414124.1.78386 WP_003414124.1.78429 WP_003414124.1.78435 WP_003414124.1.7844 WP_003414124.1.78459 WP_003414124.1.78488 WP_003414124.1.7849 WP_003414124.1.78499 WP_003414124.1.785 WP_003414124.1.78516 WP_003414124.1.78524 WP_003414124.1.78526 WP_003414124.1.78538 WP_003414124.1.78544 WP_003414124.1.78545 WP_003414124.1.78547 WP_003414124.1.78574 WP_003414124.1.78580 WP_003414124.1.7860 WP_003414124.1.78620 WP_003414124.1.78646 WP_003414124.1.78648 WP_003414124.1.78649 WP_003414124.1.78655 WP_003414124.1.78657 WP_003414124.1.78659 WP_003414124.1.7869 WP_003414124.1.78692 WP_003414124.1.78766 WP_003414124.1.78776 WP_003414124.1.78778 WP_003414124.1.78784 WP_003414124.1.78790 WP_003414124.1.78848 WP_003414124.1.78860 WP_003414124.1.7887 WP_003414124.1.78884 WP_003414124.1.78932 WP_003414124.1.78969 WP_003414124.1.78977 WP_003414124.1.78980 WP_003414124.1.79005 WP_003414124.1.79016 WP_003414124.1.79033 WP_003414124.1.79064 WP_003414124.1.79066 WP_003414124.1.79068 WP_003414124.1.79095 WP_003414124.1.79112 WP_003414124.1.79122 WP_003414124.1.79145 WP_003414124.1.79152 WP_003414124.1.79163 WP_003414124.1.79182 WP_003414124.1.79198 WP_003414124.1.79213 WP_003414124.1.79218 WP_003414124.1.79268 WP_003414124.1.79278 WP_003414124.1.79290 WP_003414124.1.79319 WP_003414124.1.79325 WP_003414124.1.79326 WP_003414124.1.79330 WP_003414124.1.79339 WP_003414124.1.79394 WP_003414124.1.79399 WP_003414124.1.79413 WP_003414124.1.79422 WP_003414124.1.79445 WP_003414124.1.79447 WP_003414124.1.79455 WP_003414124.1.79471 WP_003414124.1.79480 WP_003414124.1.79482 WP_003414124.1.79488 WP_003414124.1.79502 WP_003414124.1.79508 WP_003414124.1.79514 WP_003414124.1.79565 WP_003414124.1.79578 WP_003414124.1.79588 WP_003414124.1.79598 WP_003414124.1.79615 WP_003414124.1.79684 WP_003414124.1.79698 WP_003414124.1.797 WP_003414124.1.79744 WP_003414124.1.79784 WP_003414124.1.79806 WP_003414124.1.79819 WP_003414124.1.79826 WP_003414124.1.79828 WP_003414124.1.79851 WP_003414124.1.79853 WP_003414124.1.79863 WP_003414124.1.79881 WP_003414124.1.79885 WP_003414124.1.79898 WP_003414124.1.7990 WP_003414124.1.79900 WP_003414124.1.79913 WP_003414124.1.79918 WP_003414124.1.79947 WP_003414124.1.79948 WP_003414124.1.7995 WP_003414124.1.7997 WP_003414124.1.80004 WP_003414124.1.80015 WP_003414124.1.80022 WP_003414124.1.80030 WP_003414124.1.80054 WP_003414124.1.80084 WP_003414124.1.80099 WP_003414124.1.80129 WP_003414124.1.80177 WP_003414124.1.80234 WP_003414124.1.8026 WP_003414124.1.80275 WP_003414124.1.8029 WP_003414124.1.80299 WP_003414124.1.80304 WP_003414124.1.80326 WP_003414124.1.8037 WP_003414124.1.80370 WP_003414124.1.80399 WP_003414124.1.8044 WP_003414124.1.80451 WP_003414124.1.80458 WP_003414124.1.80461 WP_003414124.1.80490 WP_003414124.1.80503 WP_003414124.1.80507 WP_003414124.1.80552 WP_003414124.1.80576 WP_003414124.1.80588 WP_003414124.1.80599 WP_003414124.1.8060 WP_003414124.1.80624 WP_003414124.1.80636 WP_003414124.1.80673 WP_003414124.1.80711 WP_003414124.1.80714 WP_003414124.1.80743 WP_003414124.1.80784 WP_003414124.1.80815 WP_003414124.1.80853 WP_003414124.1.80918 WP_003414124.1.8093 WP_003414124.1.80967 WP_003414124.1.8097 WP_003414124.1.80988 WP_003414124.1.81007 WP_003414124.1.81013 WP_003414124.1.8105 WP_003414124.1.81059 WP_003414124.1.81066 WP_003414124.1.81075 WP_003414124.1.81091 WP_003414124.1.81119 WP_003414124.1.81125 WP_003414124.1.81136 WP_003414124.1.8114 WP_003414124.1.81189 WP_003414124.1.81192 WP_003414124.1.812 WP_003414124.1.81230 WP_003414124.1.81249 WP_003414124.1.81250 WP_003414124.1.81264 WP_003414124.1.8128 WP_003414124.1.81287 WP_003414124.1.81297 WP_003414124.1.8138 WP_003414124.1.81407 WP_003414124.1.8143 WP_003414124.1.81439 WP_003414124.1.81465 WP_003414124.1.81505 WP_003414124.1.81529 WP_003414124.1.81538 WP_003414124.1.81541 WP_003414124.1.81560 WP_003414124.1.81561 WP_003414124.1.81567 WP_003414124.1.81583 WP_003414124.1.81686 WP_003414124.1.81712 WP_003414124.1.81720 WP_003414124.1.81774 WP_003414124.1.81788 WP_003414124.1.81820 WP_003414124.1.81850 WP_003414124.1.81883 WP_003414124.1.81891 WP_003414124.1.81911 WP_003414124.1.81918 WP_003414124.1.82011 WP_003414124.1.82048 WP_003414124.1.82069 WP_003414124.1.82071 WP_003414124.1.82108 WP_003414124.1.82136 WP_003414124.1.82142 WP_003414124.1.8215 WP_003414124.1.82158 WP_003414124.1.8217 WP_003414124.1.82210 WP_003414124.1.82228 WP_003414124.1.82236 WP_003414124.1.82251 WP_003414124.1.82271 WP_003414124.1.82305 WP_003414124.1.82307 WP_003414124.1.82317 WP_003414124.1.8232 WP_003414124.1.82346 WP_003414124.1.82374 WP_003414124.1.82385 WP_003414124.1.82429 WP_003414124.1.82460 WP_003414124.1.82483 WP_003414124.1.82494 WP_003414124.1.82531 WP_003414124.1.82546 WP_003414124.1.82547 WP_003414124.1.82549 WP_003414124.1.82577 WP_003414124.1.82592 WP_003414124.1.82597 WP_003414124.1.82598 WP_003414124.1.82625 WP_003414124.1.82642 WP_003414124.1.82651 WP_003414124.1.82653 WP_003414124.1.82681 WP_003414124.1.8271 WP_003414124.1.82712 WP_003414124.1.8273 WP_003414124.1.82743 WP_003414124.1.82757 WP_003414124.1.82774 WP_003414124.1.82860 WP_003414124.1.82871 WP_003414124.1.82892 WP_003414124.1.82935 WP_003414124.1.82957 WP_003414124.1.82973 WP_003414124.1.82981 WP_003414124.1.82983 WP_003414124.1.83009 WP_003414124.1.83044 WP_003414124.1.83065 WP_003414124.1.83074 WP_003414124.1.83110 WP_003414124.1.83146 WP_003414124.1.83149 WP_003414124.1.83159 WP_003414124.1.8317 WP_003414124.1.83173 WP_003414124.1.83181 WP_003414124.1.83182 WP_003414124.1.83191 WP_003414124.1.83197 WP_003414124.1.83212 WP_003414124.1.8326 WP_003414124.1.83262 WP_003414124.1.83268 WP_003414124.1.83273 WP_003414124.1.83309 WP_003414124.1.83332 WP_003414124.1.83334 WP_003414124.1.83341 WP_003414124.1.83349 WP_003414124.1.8335 WP_003414124.1.83353 WP_003414124.1.83367 WP_003414124.1.83380 WP_003414124.1.83381 WP_003414124.1.83389 WP_003414124.1.83408 WP_003414124.1.83409 WP_003414124.1.83435 WP_003414124.1.83470 WP_003414124.1.83524 WP_003414124.1.83526 WP_003414124.1.8358 WP_003414124.1.83589 WP_003414124.1.83601 WP_003414124.1.83611 WP_003414124.1.83638 WP_003414124.1.83656 WP_003414124.1.83667 WP_003414124.1.83689 WP_003414124.1.83692 WP_003414124.1.83704 WP_003414124.1.83705 WP_003414124.1.83766 WP_003414124.1.83793 WP_003414124.1.83794 WP_003414124.1.83802 WP_003414124.1.83805 WP_003414124.1.83839 WP_003414124.1.83842 WP_003414124.1.83850 WP_003414124.1.83861 WP_003414124.1.83884 WP_003414124.1.83920 WP_003414124.1.83929 WP_003414124.1.83930 WP_003414124.1.83975 WP_003414124.1.83991 WP_003414124.1.8400 WP_003414124.1.84027 WP_003414124.1.8404 WP_003414124.1.84057 WP_003414124.1.84070 WP_003414124.1.8409 WP_003414124.1.84112 WP_003414124.1.84146 WP_003414124.1.8415 WP_003414124.1.84176 WP_003414124.1.84192 WP_003414124.1.84228 WP_003414124.1.8424 WP_003414124.1.84244 WP_003414124.1.84259 WP_003414124.1.8426 WP_003414124.1.84277 WP_003414124.1.84287 WP_003414124.1.8434 WP_003414124.1.84388 WP_003414124.1.84409 WP_003414124.1.84438 WP_003414124.1.84460 WP_003414124.1.84488 WP_003414124.1.84525 WP_003414124.1.84620 WP_003414124.1.84623 WP_003414124.1.84641 WP_003414124.1.84655 WP_003414124.1.84666 WP_003414124.1.84670 WP_003414124.1.84739 WP_003414124.1.84748 WP_003414124.1.84766 WP_003414124.1.84772 WP_003414124.1.84774 WP_003414124.1.848 WP_003414124.1.84812 WP_003414124.1.84836 WP_003414124.1.84839 WP_003414124.1.84846 WP_003414124.1.84873 WP_003414124.1.84911 WP_003414124.1.84938 WP_003414124.1.84968 WP_003414124.1.84973 WP_003414124.1.84981 WP_003414124.1.84985 WP_003414124.1.8503 WP_003414124.1.85038 WP_003414124.1.85043 WP_003414124.1.8505 WP_003414124.1.85074 WP_003414124.1.8509 WP_003414124.1.8512 WP_003414124.1.85148 WP_003414124.1.8518 WP_003414124.1.8522 WP_003414124.1.85242 WP_003414124.1.85276 WP_003414124.1.85281 WP_003414124.1.85284 WP_003414124.1.85314 WP_003414124.1.85319 WP_003414124.1.85330 WP_003414124.1.85341 WP_003414124.1.8535 WP_003414124.1.85363 WP_003414124.1.85371 WP_003414124.1.85377 WP_003414124.1.85387 WP_003414124.1.85399 WP_003414124.1.85458 WP_003414124.1.8546 WP_003414124.1.85478 WP_003414124.1.85480 WP_003414124.1.85488 WP_003414124.1.85495 WP_003414124.1.85551 WP_003414124.1.85557 WP_003414124.1.85577 WP_003414124.1.85599 WP_003414124.1.85610 WP_003414124.1.8563 WP_003414124.1.85648 WP_003414124.1.85679 WP_003414124.1.85704 WP_003414124.1.85717 WP_003414124.1.85727 WP_003414124.1.85737 WP_003414124.1.85763 WP_003414124.1.85808 WP_003414124.1.85819 WP_003414124.1.85820 WP_003414124.1.85823 WP_003414124.1.85832 WP_003414124.1.8586 WP_003414124.1.85872 WP_003414124.1.85913 WP_003414124.1.85953 WP_003414124.1.85986 WP_003414124.1.86000 WP_003414124.1.86024 WP_003414124.1.86025 WP_003414124.1.86032 WP_003414124.1.86048 WP_003414124.1.86052 WP_003414124.1.86067 WP_003414124.1.86103 WP_003414124.1.86122 WP_003414124.1.86124 WP_003414124.1.86160 WP_003414124.1.86164 WP_003414124.1.86168 WP_003414124.1.86190 WP_003414124.1.86204 WP_003414124.1.86208 WP_003414124.1.86249 WP_003414124.1.86260 WP_003414124.1.86290 WP_003414124.1.86327 WP_003414124.1.86334 WP_003414124.1.86337 WP_003414124.1.86368 WP_003414124.1.86377 WP_003414124.1.86425 WP_003414124.1.86459 WP_003414124.1.8649 WP_003414124.1.86520 WP_003414124.1.86561 WP_003414124.1.86568 WP_003414124.1.86575 WP_003414124.1.86584 WP_003414124.1.86605 WP_003414124.1.86626 WP_003414124.1.86648 WP_003414124.1.86684 WP_003414124.1.86696 WP_003414124.1.86705 WP_003414124.1.86718 WP_003414124.1.86725 WP_003414124.1.86766 WP_003414124.1.86801 WP_003414124.1.86814 WP_003414124.1.86820 WP_003414124.1.86825 WP_003414124.1.86834 WP_003414124.1.8685 WP_003414124.1.86851 WP_003414124.1.86855 WP_003414124.1.86867 WP_003414124.1.86877 WP_003414124.1.86883 WP_003414124.1.8689 WP_003414124.1.86892 WP_003414124.1.86933 WP_003414124.1.86941 WP_003414124.1.86950 WP_003414124.1.86962 WP_003414124.1.86963 WP_003414124.1.86979 WP_003414124.1.8700 WP_003414124.1.87001 WP_003414124.1.87002 WP_003414124.1.87031 WP_003414124.1.87116 WP_003414124.1.87117 WP_003414124.1.8714 WP_003414124.1.87162 WP_003414124.1.87178 WP_003414124.1.87191 WP_003414124.1.87201 WP_003414124.1.87209 WP_003414124.1.87240 WP_003414124.1.87266 WP_003414124.1.87273 WP_003414124.1.87275 WP_003414124.1.8733 WP_003414124.1.87345 WP_003414124.1.87369 WP_003414124.1.8737 WP_003414124.1.87401 WP_003414124.1.87404 WP_003414124.1.87409 WP_003414124.1.87444 WP_003414124.1.87446 WP_003414124.1.87459 WP_003414124.1.87472 WP_003414124.1.87489 WP_003414124.1.87494 WP_003414124.1.87496 WP_003414124.1.87582 WP_003414124.1.87588 WP_003414124.1.87617 WP_003414124.1.87620 WP_003414124.1.87634 WP_003414124.1.87643 WP_003414124.1.8765 WP_003414124.1.87650 WP_003414124.1.87654 WP_003414124.1.87658 WP_003414124.1.87665 WP_003414124.1.87676 WP_003414124.1.87677 WP_003414124.1.87684 WP_003414124.1.87692 WP_003414124.1.87707 WP_003414124.1.87732 WP_003414124.1.87784 WP_003414124.1.87796 WP_003414124.1.87809 WP_003414124.1.87817 WP_003414124.1.87827 WP_003414124.1.87831 WP_003414124.1.87835 WP_003414124.1.87837 WP_003414124.1.87866 WP_003414124.1.8789 WP_003414124.1.87911 WP_003414124.1.87924 WP_003414124.1.87951 WP_003414124.1.87956 WP_003414124.1.87991 WP_003414124.1.88 WP_003414124.1.88002 WP_003414124.1.88037 WP_003414124.1.88039 WP_003414124.1.88072 WP_003414124.1.88077 WP_003414124.1.88121 WP_003414124.1.88191 WP_003414124.1.88205 WP_003414124.1.88217 WP_003414124.1.88219 WP_003414124.1.88245 WP_003414124.1.88253 WP_003414124.1.88294 WP_003414124.1.88315 WP_003414124.1.88316 WP_003414124.1.88320 WP_003414124.1.88338 WP_003414124.1.8840 WP_003414124.1.88437 WP_003414124.1.88453 WP_003414124.1.88469 WP_003414124.1.88489 WP_003414124.1.88507 WP_003414124.1.88521 WP_003414124.1.88530 WP_003414124.1.88537 WP_003414124.1.88541 WP_003414124.1.88592 WP_003414124.1.88616 WP_003414124.1.88618 WP_003414124.1.8862 WP_003414124.1.88625 WP_003414124.1.88632 WP_003414124.1.88634 WP_003414124.1.88649 WP_003414124.1.8870 WP_003414124.1.88737 WP_003414124.1.88824 WP_003414124.1.88886 WP_003414124.1.88965 WP_003414124.1.88985 WP_003414124.1.8902 WP_003414124.1.89025 WP_003414124.1.89041 WP_003414124.1.89046 WP_003414124.1.89082 WP_003414124.1.89162 WP_003414124.1.89168 WP_003414124.1.8917 WP_003414124.1.89205 WP_003414124.1.89207 WP_003414124.1.89225 WP_003414124.1.8925 WP_003414124.1.89277 WP_003414124.1.89286 WP_003414124.1.89293 WP_003414124.1.89320 WP_003414124.1.8935 WP_003414124.1.89371 WP_003414124.1.89378 WP_003414124.1.89392 WP_003414124.1.89406 WP_003414124.1.8943 WP_003414124.1.89451 WP_003414124.1.89453 WP_003414124.1.89473 WP_003414124.1.89475 WP_003414124.1.89483 WP_003414124.1.895 WP_003414124.1.89513 WP_003414124.1.89517 WP_003414124.1.89522 WP_003414124.1.89567 WP_003414124.1.8957 WP_003414124.1.89572 WP_003414124.1.89589 WP_003414124.1.89613 WP_003414124.1.89625 WP_003414124.1.89648 WP_003414124.1.8967 WP_003414124.1.89670 WP_003414124.1.89676 WP_003414124.1.89729 WP_003414124.1.89739 WP_003414124.1.89762 WP_003414124.1.8977 WP_003414124.1.89802 WP_003414124.1.89808 WP_003414124.1.8982 WP_003414124.1.89829 WP_003414124.1.89831 WP_003414124.1.89844 WP_003414124.1.89849 WP_003414124.1.8989 WP_003414124.1.89903 WP_003414124.1.89909 WP_003414124.1.89922 WP_003414124.1.89926 WP_003414124.1.89963 WP_003414124.1.89971 WP_003414124.1.8998 WP_003414124.1.89987 WP_003414124.1.900 WP_003414124.1.90048 WP_003414124.1.9007 WP_003414124.1.90080 WP_003414124.1.90130 WP_003414124.1.90134 WP_003414124.1.90137 WP_003414124.1.90157 WP_003414124.1.90184 WP_003414124.1.90199 WP_003414124.1.90231 WP_003414124.1.90245 WP_003414124.1.90308 WP_003414124.1.90322 WP_003414124.1.90328 WP_003414124.1.90372 WP_003414124.1.90481 WP_003414124.1.90499 WP_003414124.1.9050 WP_003414124.1.90527 WP_003414124.1.90550 WP_003414124.1.90560 WP_003414124.1.90612 WP_003414124.1.90640 WP_003414124.1.90672 WP_003414124.1.90687 WP_003414124.1.90691 WP_003414124.1.90711 WP_003414124.1.90722 WP_003414124.1.90744 WP_003414124.1.9075 WP_003414124.1.90756 WP_003414124.1.90767 WP_003414124.1.90771 WP_003414124.1.90785 WP_003414124.1.90788 WP_003414124.1.90800 WP_003414124.1.90810 WP_003414124.1.90816 WP_003414124.1.90819 WP_003414124.1.9082 WP_003414124.1.90831 WP_003414124.1.90884 WP_003414124.1.90899 WP_003414124.1.90906 WP_003414124.1.90958 WP_003414124.1.90976 WP_003414124.1.90977 WP_003414124.1.90987 WP_003414124.1.9102 WP_003414124.1.91026 WP_003414124.1.91032 WP_003414124.1.91053 WP_003414124.1.91082 WP_003414124.1.91106 WP_003414124.1.91112 WP_003414124.1.91144 WP_003414124.1.91151 WP_003414124.1.91157 WP_003414124.1.91167 WP_003414124.1.91169 WP_003414124.1.91192 WP_003414124.1.91201 WP_003414124.1.91207 WP_003414124.1.91208 WP_003414124.1.91211 WP_003414124.1.91214 WP_003414124.1.91230 WP_003414124.1.91244 WP_003414124.1.91251 WP_003414124.1.91260 WP_003414124.1.91265 WP_003414124.1.9128 WP_003414124.1.91284 WP_003414124.1.91294 WP_003414124.1.91303 WP_003414124.1.91322 WP_003414124.1.91386 WP_003414124.1.9139 WP_003414124.1.91398 WP_003414124.1.91411 WP_003414124.1.91430 WP_003414124.1.91436 WP_003414124.1.91483 WP_003414124.1.91496 WP_003414124.1.91507 WP_003414124.1.91508 WP_003414124.1.91576 WP_003414124.1.91589 WP_003414124.1.91694 WP_003414124.1.91695 WP_003414124.1.91716 WP_003414124.1.91717 WP_003414124.1.91728 WP_003414124.1.91743 WP_003414124.1.91759 WP_003414124.1.91784 WP_003414124.1.91785 WP_003414124.1.91786 WP_003414124.1.91802 WP_003414124.1.91822 WP_003414124.1.91828 WP_003414124.1.9189 WP_003414124.1.91896 WP_003414124.1.9190 WP_003414124.1.91931 WP_003414124.1.91944 WP_003414124.1.91953 WP_003414124.1.91957 WP_003414124.1.91976 WP_003414124.1.92021 WP_003414124.1.92083 WP_003414124.1.92127 WP_003414124.1.92144 WP_003414124.1.92150 WP_003414124.1.92153 WP_003414124.1.92190 WP_003414124.1.92192 WP_003414124.1.92200 WP_003414124.1.92220 WP_003414124.1.92221 WP_003414124.1.92222 WP_003414124.1.92289 WP_003414124.1.9229 WP_003414124.1.92294 WP_003414124.1.92300 WP_003414124.1.92317 WP_003414124.1.92334 WP_003414124.1.92338 WP_003414124.1.92345 WP_003414124.1.92356 WP_003414124.1.92364 WP_003414124.1.92380 WP_003414124.1.92428 WP_003414124.1.92447 WP_003414124.1.92456 WP_003414124.1.92467 WP_003414124.1.92471 WP_003414124.1.92490 WP_003414124.1.92508 WP_003414124.1.9251 WP_003414124.1.92511 WP_003414124.1.92523 WP_003414124.1.92527 WP_003414124.1.92536 WP_003414124.1.92592 WP_003414124.1.92597 WP_003414124.1.92603 WP_003414124.1.92606 WP_003414124.1.92610 WP_003414124.1.92613 WP_003414124.1.9263 WP_003414124.1.9265 WP_003414124.1.92650 WP_003414124.1.92677 WP_003414124.1.92685 WP_003414124.1.92689 WP_003414124.1.92690 WP_003414124.1.92714 WP_003414124.1.92736 WP_003414124.1.9274 WP_003414124.1.92760 WP_003414124.1.92777 WP_003414124.1.92803 WP_003414124.1.92833 WP_003414124.1.92856 WP_003414124.1.92881 WP_003414124.1.92892 WP_003414124.1.92907 WP_003414124.1.92908 WP_003414124.1.9291 WP_003414124.1.92917 WP_003414124.1.92996 WP_003414124.1.93006 WP_003414124.1.93008 WP_003414124.1.93009 WP_003414124.1.93015 WP_003414124.1.93043 WP_003414124.1.93083 WP_003414124.1.93097 WP_003414124.1.93137 WP_003414124.1.93192 WP_003414124.1.93203 WP_003414124.1.93212 WP_003414124.1.93234 WP_003414124.1.93245 WP_003414124.1.93257 WP_003414124.1.93265 WP_003414124.1.93297 WP_003414124.1.93320 WP_003414124.1.93328 WP_003414124.1.93337 WP_003414124.1.93343 WP_003414124.1.93349 WP_003414124.1.93363 WP_003414124.1.93377 WP_003414124.1.9338 WP_003414124.1.93407 WP_003414124.1.93417 WP_003414124.1.93419 WP_003414124.1.93426 WP_003414124.1.9344 WP_003414124.1.93443 WP_003414124.1.93447 WP_003414124.1.93483 WP_003414124.1.93487 WP_003414124.1.93495 WP_003414124.1.93499 WP_003414124.1.93516 WP_003414124.1.93536 WP_003414124.1.93544 WP_003414124.1.93555 WP_003414124.1.93560 WP_003414124.1.93564 WP_003414124.1.9357 WP_003414124.1.93573 WP_003414124.1.93588 WP_003414124.1.9363 WP_003414124.1.93645 WP_003414124.1.93649 WP_003414124.1.93659 WP_003414124.1.93677 WP_003414124.1.9368 WP_003414124.1.93689 WP_003414124.1.93693 WP_003414124.1.93698 WP_003414124.1.93706 WP_003414124.1.9371 WP_003414124.1.93792 WP_003414124.1.93823 WP_003414124.1.93871 WP_003414124.1.9388 WP_003414124.1.93894 WP_003414124.1.93903 WP_003414124.1.93907 WP_003414124.1.93913 WP_003414124.1.93950 WP_003414124.1.93953 WP_003414124.1.93954 WP_003414124.1.93988 WP_003414124.1.9407 WP_003414124.1.94143 WP_003414124.1.94154 WP_003414124.1.94184 WP_003414124.1.94204 WP_003414124.1.94205 WP_003414124.1.94226 WP_003414124.1.94231 WP_003414124.1.94256 WP_003414124.1.94261 WP_003414124.1.94281 WP_003414124.1.94292 WP_003414124.1.94297 WP_003414124.1.9431 WP_003414124.1.94326 WP_003414124.1.94339 WP_003414124.1.94392 WP_003414124.1.94416 WP_003414124.1.94421 WP_003414124.1.94456 WP_003414124.1.94470 WP_003414124.1.94480 WP_003414124.1.94495 WP_003414124.1.94511 WP_003414124.1.94512 WP_003414124.1.94525 WP_003414124.1.94528 WP_003414124.1.94564 WP_003414124.1.94623 WP_003414124.1.94629 WP_003414124.1.9465 WP_003414124.1.94673 WP_003414124.1.94730 WP_003414124.1.94736 WP_003414124.1.94776 WP_003414124.1.9478 WP_003414124.1.94834 WP_003414124.1.94852 WP_003414124.1.94872 WP_003414124.1.94902 WP_003414124.1.94916 WP_003414124.1.94979 WP_003414124.1.94994 WP_003414124.1.94996 WP_003414124.1.94998 WP_003414124.1.95007 WP_003414124.1.95010 WP_003414124.1.95015 WP_003414124.1.95034 WP_003414124.1.95068 WP_003414124.1.95081 WP_003414124.1.95082 WP_003414124.1.9509 WP_003414124.1.95096 WP_003414124.1.95112 WP_003414124.1.9514 WP_003414124.1.95179 WP_003414124.1.95188 WP_003414124.1.95234 WP_003414124.1.95241 WP_003414124.1.95245 WP_003414124.1.95257 WP_003414124.1.95279 WP_003414124.1.9531 WP_003414124.1.95335 WP_003414124.1.95344 WP_003414124.1.9535 WP_003414124.1.95370 WP_003414124.1.95392 WP_003414124.1.95416 WP_003414124.1.95417 WP_003414124.1.95454 WP_003414124.1.95455 WP_003414124.1.95491 WP_003414124.1.95497 WP_003414124.1.95508 WP_003414124.1.95509 WP_003414124.1.95529 WP_003414124.1.95557 WP_003414124.1.95565 WP_003414124.1.95578 WP_003414124.1.95580 WP_003414124.1.95585 WP_003414124.1.95679 WP_003414124.1.95685 WP_003414124.1.957 WP_003414124.1.95724 WP_003414124.1.95727 WP_003414124.1.95730 WP_003414124.1.95735 WP_003414124.1.95758 WP_003414124.1.95772 WP_003414124.1.95797 WP_003414124.1.95839 WP_003414124.1.9585 WP_003414124.1.9590 WP_003414124.1.95902 WP_003414124.1.95908 WP_003414124.1.95924 WP_003414124.1.95926 WP_003414124.1.95953 WP_003414124.1.95958 WP_003414124.1.95964 WP_003414124.1.95973 WP_003414124.1.96006 WP_003414124.1.9602 WP_003414124.1.96036 WP_003414124.1.96062 WP_003414124.1.96065 WP_003414124.1.96098 WP_003414124.1.96146 WP_003414124.1.96166 WP_003414124.1.96171 WP_003414124.1.96182 WP_003414124.1.96204 WP_003414124.1.96230 WP_003414124.1.96235 WP_003414124.1.96242 WP_003414124.1.96245 WP_003414124.1.96254 WP_003414124.1.96259 WP_003414124.1.96286 WP_003414124.1.96313 WP_003414124.1.96318 WP_003414124.1.96345 WP_003414124.1.96360 WP_003414124.1.96373 WP_003414124.1.96456 WP_003414124.1.96486 WP_003414124.1.96560 WP_003414124.1.96569 WP_003414124.1.96573 WP_003414124.1.96575 WP_003414124.1.96576 WP_003414124.1.96611 WP_003414124.1.96621 WP_003414124.1.9667 WP_003414124.1.96681 WP_003414124.1.96726 WP_003414124.1.96733 WP_003414124.1.96742 WP_003414124.1.96754 WP_003414124.1.9678 WP_003414124.1.96832 WP_003414124.1.9685 WP_003414124.1.97008 WP_003414124.1.97056 WP_003414124.1.97084 WP_003414124.1.97094 WP_003414124.1.97096 WP_003414124.1.97099 WP_003414124.1.97108 WP_003414124.1.97113 WP_003414124.1.97122 WP_003414124.1.97127 WP_003414124.1.97129 WP_003414124.1.97136 WP_003414124.1.9716 WP_003414124.1.97176 WP_003414124.1.97222 WP_003414124.1.97237 WP_003414124.1.97242 WP_003414124.1.97270 WP_003414124.1.97283 WP_003414124.1.97296 WP_003414124.1.97321 WP_003414124.1.97325 WP_003414124.1.97330 WP_003414124.1.97366 WP_003414124.1.97376 WP_003414124.1.97380 WP_003414124.1.97462 WP_003414124.1.97517 WP_003414124.1.97519 WP_003414124.1.97535 WP_003414124.1.97540 WP_003414124.1.97545 WP_003414124.1.97546 WP_003414124.1.97550 WP_003414124.1.97568 WP_003414124.1.97584 WP_003414124.1.9759 WP_003414124.1.97591 WP_003414124.1.97596 WP_003414124.1.97609 WP_003414124.1.97618 WP_003414124.1.9763 WP_003414124.1.97669 WP_003414124.1.97673 WP_003414124.1.97700 WP_003414124.1.97701 WP_003414124.1.9773 WP_003414124.1.97730 WP_003414124.1.97740 WP_003414124.1.97751 WP_003414124.1.97754 WP_003414124.1.97797 WP_003414124.1.9782 WP_003414124.1.9784 WP_003414124.1.97888 WP_003414124.1.9790 WP_003414124.1.9795 WP_003414124.1.97951 WP_003414124.1.97958 WP_003414124.1.97966 WP_003414124.1.97977 WP_003414124.1.97979 WP_003414124.1.97995 WP_003414124.1.98018 WP_003414124.1.98034 WP_003414124.1.98052 WP_003414124.1.98071 WP_003414124.1.98072 WP_003414124.1.98113 WP_003414124.1.98114 WP_003414124.1.98128 WP_003414124.1.98188 WP_003414124.1.98189 WP_003414124.1.98213 WP_003414124.1.98225 WP_003414124.1.98291 WP_003414124.1.98335 WP_003414124.1.98350 WP_003414124.1.98395 WP_003414124.1.98441 WP_003414124.1.98443 WP_003414124.1.9848 WP_003414124.1.98482 WP_003414124.1.98486 WP_003414124.1.98488 WP_003414124.1.98503 WP_003414124.1.98516 WP_003414124.1.98536 WP_003414124.1.98541 WP_003414124.1.98566 WP_003414124.1.98576 WP_003414124.1.98590 WP_003414124.1.98594 WP_003414124.1.98599 WP_003414124.1.98629 WP_003414124.1.98645 WP_003414124.1.98646 WP_003414124.1.98649 WP_003414124.1.98656 WP_003414124.1.9867 WP_003414124.1.98674 WP_003414124.1.98697 WP_003414124.1.98701 WP_003414124.1.98739 WP_003414124.1.98749 WP_003414124.1.98765 WP_003414124.1.98770 WP_003414124.1.98777 WP_003414124.1.98802 WP_003414124.1.98838 WP_003414124.1.98906 WP_003414124.1.98935 WP_003414124.1.98948 WP_003414124.1.98953 WP_003414124.1.98984 WP_003414124.1.99000 WP_003414124.1.99023 WP_003414124.1.99030 WP_003414124.1.99037 WP_003414124.1.99055 WP_003414124.1.99062 WP_003414124.1.99086 WP_003414124.1.99115 WP_003414124.1.99161 WP_003414124.1.99211 WP_003414124.1.99216 WP_003414124.1.99222 WP_003414124.1.99251 WP_003414124.1.99269 WP_003414124.1.99294 WP_003414124.1.99316 WP_003414124.1.99322 WP_003414124.1.99328 WP_003414124.1.99365 WP_003414124.1.99368 WP_003414124.1.99379 WP_003414124.1.99396 WP_003414124.1.99402 WP_003414124.1.99404 WP_003414124.1.99419 WP_003414124.1.99438 WP_003414124.1.99460 WP_003414124.1.99468 WP_003414124.1.99473 WP_003414124.1.99513 WP_003414124.1.99529 WP_003414124.1.99548 WP_003414124.1.99572 WP_003414124.1.99575 WP_003414124.1.99578 WP_003414124.1.99605 WP_003414124.1.99609 WP_003414124.1.99617 WP_003414124.1.99635 WP_003414124.1.99650 WP_003414124.1.99672 WP_003414124.1.99701 WP_003414124.1.99711 WP_003414124.1.99716 WP_003414124.1.99740 WP_003414124.1.99745 WP_003414124.1.99749 WP_003414124.1.9976 WP_003414124.1.99798 WP_003414124.1.99817 WP_003414124.1.99832 WP_003414124.1.99847 WP_003414124.1.99852 WP_003414124.1.99886 WP_003414124.1.99897 WP_003414124.1.99899 WP_003414124.1.99915 WP_003414124.1.9993 WP_003414124.1.99982 WP_003414124.1.99991 gi|506927326|ref|YP_008007776.1| gi|148823971|ref|YP_001288725.1| gi|15842321|ref|NP_337358.1| gi|15609920|ref|NP_217299.1| gi|506927326|ref|YP_008007776.1| gi|392431609|ref|YP_006472653.1| gi|392387415|ref|YP_005309044.1| gi|479056747|ref|YP_007352553.1| gi|494701216|ref|YP_007966698.1| gi|385999564|ref|YP_005917863.1| gi|197738425|ref|YP_002159740.1| gi|449064855|ref|YP_007431938.1| 233413.Mb2806c 336982.TBFG_12796 410289.BCG_2801c 419947.MRA_2807 478434.TBMG_01191 561275.JTY_2795 83331.MT2853 83332.Rv2783c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]