SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525707697|ref|YP_008236710.1| from Lactobacillus helveticus CNRZ32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525707697|ref|YP_008236710.1|
Domain Number 1 Region: 9-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-84
Family Protein kinases, catalytic subunit 0.00000314
Further Details:      
 
Domain Number 2 Region: 430-488
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|525707697|ref|YP_008236710.1|
Domain Number - Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525707697|ref|YP_008236710.1|
Sequence length 671
Comment serine/threonine protein kinase [Lactobacillus helveticus CNRZ32]
Sequence
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKRE
ALATSELSHPNIVSVLDVGTDHGLHYMVMEYVDGPDLKEYIHQNAPLDLHEVIRIMDKIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQ
ALENVVLRATAKDPRDRYATAQAMQADLDSSLDPERADEPVFVPNHGNNNDKTIVLPGFK
APEKEQPTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNK
PHQVHIPDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKA
IILIVSSGSSMVKVPNVVGDNYDEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGV
EVKPTQTTITLVVSRGKKVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEV
EKGLVISMQPEAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNNDDKSDSK
SWDASNKEDSSKGDHVQIYIKDDDHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRN
RETVLNEKVTK
Download sequence
Identical sequences A0A0D5MIF6 F3MLW2 U6FDU5 U6FR81
WP_003627581.1.14203 WP_003627581.1.19265 WP_003627581.1.28755 WP_003627581.1.30073 WP_003627581.1.346 WP_003627581.1.41975 WP_003627581.1.48628 WP_003627581.1.61320 WP_003627581.1.6900 WP_003627581.1.70034 WP_003627581.1.87032 WP_003627581.1.99011 gi|525707697|ref|YP_008236710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]