SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMM026C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMM026C
Domain Number 1 Region: 896-1059
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.61e-58
Family Polyphosphate kinase C-terminal domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 721-891
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.66e-45
Family Polyphosphate kinase C-terminal domain 0.0000553
Further Details:      
 
Domain Number 3 Region: 464-519,561-700
Classification Level Classification E-value
Superfamily PHP14-like 1.43e-42
Family PPK middle domain-like 0.00042
Further Details:      
 
Domain Number 4 Region: 1163-1261
Classification Level Classification E-value
Superfamily Nudix 8.12e-16
Family MutT-like 0.0035
Further Details:      
 
Domain Number 5 Region: 379-459
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 0.0000000000000102
Family PPK N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMM026C
Sequence length 1302
Comment polyphosphate kinase
Sequence
MRCCELGPNTGADQPERTEPPSETSESDEVAAAVAAAAAAAGDLADRLTRSVDEQSRSAG
CAASGAQDKPQTLCSVQDVTASTAQRFDVRQSKECGEAVQNFSELGVGKQQEHADPRTVW
LPGSPEPTAFPQVRLVGNWDLPMVPMNEEPSEYTSSVREGAVPDLCEEGSVTRASRIGAC
VVQAASHSREAVAGDAQSTDDQESEMHTASASTTTASSLKQCTADGKSGESTQRLHTDSR
ASSGIAFVPYKSEEEVLADLELEDSMDDHTYTLLDLRKSLPEQMQRRSYACPTVRDGSRS
DRHLDRRAFRGENEEEHDDDSSSGPDRDVWTPPATPLDSEMPLIVCPPEPVWPCEEDLRD
LTPAELARSTDVFMQVAEELHFHWRVLKLGTDPVTPTPLLERLKFLCIVSSNLDEYFSKN
MYDVSKTMRPLYERISAAIRDITAQQESCFTDVILPALARYDMRILRYADLSMTQRAQMN
AFFHARLFPLLTPLTLDPTHPFPLLRSHSLYLAVLLKGAQLMPPSEHDAHDGDESPIPAL
SPPNASLDRSIATALPSDTHVAWVRVPSSCSRFITVDNEKRFLPVEEIIIQNLDALFENV
RVIAAYPFRVTRNTKLELDKIELNESEDFLKIVEENLYSRQRRAAVRLEVSRDMPDVLTT
LLREQLNLEPLAMYRSRAPIIGLNDCFMLTNVNIPALRYPPWRFKTHSILAGYKYGVQSG
HTAHMFELIRHNDVLFSFPIHSFDETTLRFLESAVRDPAVRLMKMVLYRCGNNSPVVKLL
MEAARRGIDVNVLVELKASFDEDQNVLYARMLQEAGCNVAYGVKGYKTHAKLILVVREEN
HALVSYCNVATGNYNATTAKIYTDFSLFTSREDICADVTDLFNVFTGYSAKRSFRKLLVS
PVNMRDRFLELIQREIDNARAGYPARIICQCNGITEVLITQRLYEASMAGVRVDLIVRGI
CRVRPGITGISENIRVVSILGRFLLHARVFYFANAREAKPEYYIGSADWRTRNLLARLEA
VAPVEDKYLQQTLWRHLNRLLSDSVNGWEMLPDGRYVKGESEALGHLRDAIMAARREAEA
EALKPPAQAPVSADEVTPGSSEAEHLPVVRKAGCVPVRLNRRHNTRRDDIGTRYEVLLIT
STSSSFIARHPNDSRVSEIPDGGITWVFPKGSMAYGEDGRSAALREALEEAGVSGELGPL
LSVSTKRKRRTVVMTEFYLLHVKQQLSQWGESSQRHRRWFTLDEAANVITKEYLLEALMK
ARQALGETPTSQPTSPPAPPAPPPAAAAAAAFESTTNGGKKH
Download sequence
Identical sequences M1VDN3
gnl|CMER|CMM026C CMM026CT XP_005536958.1.94140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]