SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMR181C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMR181C
Domain Number 1 Region: 286-352
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000392
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0015
Further Details:      
 
Domain Number 2 Region: 214-284
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000929
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0066
Further Details:      
 
Domain Number 3 Region: 356-455
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000432
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMR181C
Sequence length 461
Comment similar to small conductance mechanosensitive ion channel
Sequence
MEKLATQTLSFVPLQGNPFSGVGYHTHRIFSRDARLKLCRWKKRALPAVSVLPRGVGRLL
LAHAGQHQRQALSSLWQAHLSTHVHNLDIGSILETPVSLGGKSRLVAAFTLSDLLVILIL
LVAYRRMVRILARSVLQPAGARLPDKWLTRKLIPADEHGLVRWIESTERAVGLFLTLRLG
VMACQFGLVLGARLGITIWPKLPYVISRLATIGYFAFVLDTFYNWFLYEREDLSLSQIFV
LGRLGTVLIYAVAFLVFVETTGLPLRSILAFGGIGGLAVGLATQELAKNFISGIMLALGA
PFAPGESVQLNTLGVSGQVRQIGFYKTELIGADGRPIWIPNAQLLNERLTNNSRITNRRI
NLRFGLRYQDIDKIGRIVERVREMLAEVPEIAAYRESISVFFTEFAEYSLPIQLSCIVNV
TDGRRFLEIQQQVLIELNRIVKSELADFALPTRAIEYLPPR
Download sequence
Identical sequences M1UW96
CMR181CT XP_005538462.1.94140 gnl|CMER|CMR181C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]