SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161611233|ref|YP_278670.2| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161611233|ref|YP_278670.2|
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily L21p-like 6.54e-31
Family Ribosomal protein L21p 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161611233|ref|YP_278670.2|
Sequence length 100
Comment 50S ribosomal protein L21 [Mycoplasma synoviae 53]
Sequence
MFAIIETGGKQILVKEGDSIYVEKLEGQEKSEVKFDKVLAVNDVFGKPYVTGAVVHGTIE
KQGKAKKIVVYRHNPKSTHKRKLGHRQPYTLVKITKIKGK
Download sequence
Identical sequences A0A0E3H7X5 A0A2H4CDG8 Q4A5L2
WP_011283688.1.100025 WP_011283688.1.28789 WP_011283688.1.35279 WP_011283688.1.65622 262723.MS53_0551 gi|161611233|ref|YP_278670.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]