SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894053|ref|YP_278161.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894053|ref|YP_278161.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 8.5e-29
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71894053|ref|YP_278161.1|
Sequence length 155
Comment pentitol phosphotransferase enzyme II, A component [Mycoplasma synoviae 53]
Sequence
MNFLENLIENDSILLQQEASNWQEAIKLSTNLLEKAKIINQNYYLNILESTAKYGPYYVI
IDGFAMPHASGTSDSVFGNGFSLVTLKNPVVFENNVKVSVLVCVAAIDGETHTKIAIPQL
VAIFESPENIAKITSFQTKEQVIDFISKIDYTKYL
Download sequence
Identical sequences gi|71894053|ref|YP_278161.1| 262723.MS53_0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]