SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894170|ref|YP_278278.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894170|ref|YP_278278.1|
Domain Number 1 Region: 699-845
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.22e-43
Family Glucose permease-like 0.00015
Further Details:      
 
Domain Number 2 Region: 588-660
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.000000000000129
Family Glucose permease domain IIB 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71894170|ref|YP_278278.1|
Sequence length 860
Comment PTS system, glucose-specific IIABC component [Mycoplasma synoviae 53]
Sequence
MSIAKLGSFFRSKKEKNSDNSGSGNARKILSKLSGAFMLPISVMAIAGLFLGVGATVAEK
AAGVAAVQKIGELLKILGDPVFGALPLLFAAAFVIAFTDEAGVAVFAAIIGYLVFSAVQG
VFITPVTSTVDGKEVIDGYVVLFEQGGRSAKSLKQLVGSTLGIRSLQTSVFGGIVVGLVV
QYLYNKFHTIQLPRVISFFGGKRFVSLVTIPAMAVLAFVFLLFWPWVGIALNFLGEALNK
TPVGVNSLIFGYIERSLIPFGLHHVFYAPVWYTPAGGDLNAALQAFVSTNSLPLDLSLEG
AEGAAAAAGVSEGYANFVKLFQDVAKEPNGFQGDSTISLKLLGYGNTVALFSPTELVALK
NPSSTIPTTLSWVGKTISQPVTVAGKTYYLYSNVPLFAFVQYALNIKIGQYLDGKFGVMM
LALPAAAAAMIFAAPKENRKVAAGTVVPAAFTSLITGVTEPIEFTFLFLSPLLFWGFHSI
MAAFSFMFANLLNVHIPMAFSGGILDFVIYGVIPFQKGTQFWFPLLTGAAYMPVYFFVFY
FWIKYKNLETPGRGGNTKLFTRKDYEAKKDAKHSAEGMTSAKTVDPQAYAVVQAYGGTEN
ITAYNNCASRLRYDVKDVRKVNPEALKAAGAVAVKFEGSNHAQGIFGPVAEQLNSKIKSQ
RDLIAAKEAEEKASSVRKLDQAPVVEKEVVKKETPVRKTTVEQLTKPVSLYTPARGDLKP
LEYLNDGVFSNKTMGDGFVVRFVSEKVGNVYSPVDGVVTLVFPTKHAYGIETKEGVKLLV
HIGIDTVNLNGQGFESFVKLGQKVKAGDQLAKVDLPFLKRHKVKSDVITLVLPESKYKNF
SVTLDTNEVPKLGIRVGLVR
Download sequence
Identical sequences Q4A6Q4
WP_011283310.1.35279 262723.MS53_0147 gi|71894170|ref|YP_278278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]