SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894190|ref|YP_278298.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894190|ref|YP_278298.1|
Domain Number 1 Region: 160-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.92e-52
Family G proteins 0.0000139
Further Details:      
 
Domain Number 2 Region: 3-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.09e-47
Family Obg GTP-binding protein N-terminal domain 0.0000112
Further Details:      
 
Domain Number 3 Region: 350-423
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.57e-18
Family Obg GTP-binding protein C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71894190|ref|YP_278298.1|
Sequence length 424
Comment GTPase ObgE [Mycoplasma synoviae 53]
Sequence
MAKFIDQVKIMLKAGKGGDGMISFRREAHVDKGGPDGGDGGTGGNIYFVADLGKNTLLSF
YKNKFIIAEDGVKGGPKNLYGAKGKDTIVKVPLGTLVYKNKKIVADVIKENHLYLVAKGG
KGGRGNNKFKTSKNTAPRIAENGMPGEKYEANIVLKILSDVGLVGLPSCGKSTLINALSN
AKAKVAEYEFTTLVPQLGLVKYYDYSYTIADLPGLIKGASLGKGLGIQFLRHIERCKVVI
HIVDFGSLDKDPIQSYEAIQKELESYKLNLTQKPQLVVANKSDLANFKNNIEKFKAKYPN
IEIIEISALNYHNVENLKKIIWEFLEKTSHLQIKIEDDFETEVKEINYEPDFVIQKMNQN
HFKVTGKKIEELVLKIPINTFDNLMRFNNILKKIGVWEALIKRDIQKGDLVEIYQHKFEW
EEEL
Download sequence
Identical sequences Q4A6N4
gi|71894190|ref|YP_278298.1| WP_011283330.1.35279 262723.MS53_0168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]