SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894449|ref|YP_278557.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894449|ref|YP_278557.1|
Domain Number 1 Region: 46-117
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0000000000458
Family Glucose permease domain IIB 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71894449|ref|YP_278557.1|
Sequence length 122
Comment PTS system glucose-specific enzyme IIB component [Mycoplasma synoviae 53]
Sequence
MMLKIRLKKILLILFTLGFIYRKWDKALEKKENTVYQSAKLPFDFKELLLYLGGPENLKS
LEKTTSRVLVFFEDKSLIDQNKLMSLKGINGIFFKSDSIALVLGEYTQVTYDKLLEQKHE
SK
Download sequence
Identical sequences 262723.MS53_0434 gi|71894449|ref|YP_278557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]