SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894549|ref|YP_278657.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894549|ref|YP_278657.1|
Domain Number 1 Region: 21-94,121-177
Classification Level Classification E-value
Superfamily PEBP-like 9.55e-24
Family Prokaryotic PEBP-like proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71894549|ref|YP_278657.1|
Sequence length 179
Comment hypothetical protein MS53_0538 [Mycoplasma synoviae 53]
Sequence
MYVNSKFFEVKGKELWLKPEGVQSKDGRFLVFDLDWKEMPKAKSYALTLVDYEASRVIGQ
PFVHFAAANITSTHLKHGENLEKTQWVMGVNSRVPGARENSNGVHVECIPAAFKASSFEE
ACDYFPPMPPDKKHLYTLKVYGLDTDKLDLEKGFFLGDLNRAMLDHVVDVYTVNFWYKQ
Download sequence
Identical sequences Q4A5M5
gi|71894549|ref|YP_278657.1| WP_011283675.1.35279 262723.MS53_0538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]