SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71894677|ref|YP_278785.1| from Mycoplasma synoviae 53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71894677|ref|YP_278785.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-59
Family G proteins 0.000000122
Further Details:      
 
Domain Number 2 Region: 302-394
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.44e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000133
Further Details:      
 
Domain Number 3 Region: 206-301
Classification Level Classification E-value
Superfamily Translation proteins 6.65e-30
Family Elongation factors 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71894677|ref|YP_278785.1|
Sequence length 394
Comment elongation factor Tu [Mycoplasma synoviae 53]
Sequence
MAKLDFDRSKEHVNVGTIGHVDHGKTTLTAAIATVLSKKGLSEARDYASIDNAPEEKARG
ITINTSHIEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLSKQVGVPRMVVFLNKCDMVDDEEMIGLVEMEIRDLLSEYGFDGDNAPIVRGSALKALE
GDAVYEDKILELMNAVDTYIENPVKELDKPFLMAVEDVFTITGRGTVATGRVERGRLTLN
EEVEIVGLKPTKKTVVTGIEMFRKNLKEALAGDNAGLLLRGVNRDDVERGQVLAKPGSIV
PHTEFEAAIYVLKKEEGGRHTPFFKNYKPQFYFRTTDVTGGVEFEAGREMVMPGENVNLK
VKLISPIAVEEGTKFSIREGGRTVGAGSVTKIVK
Download sequence
Identical sequences Q4A597
WP_011283803.1.35279 262723.MS53_0667 gi|71894677|ref|YP_278785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]