SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|148964|GID1.0039653 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|148964|GID1.0039653
Domain Number 1 Region: 2223-2413
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.16e-44
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 2 Region: 158-273
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-32
Family Second domain of FERM 0.0000321
Further Details:      
 
Domain Number 3 Region: 274-364
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-21
Family Third domain of FERM 0.0001
Further Details:      
 
Domain Number 4 Region: 2533-2595
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.27e-19
Family VHP, Villin headpiece domain 0.00076
Further Details:      
 
Domain Number 5 Region: 2082-2212
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000000018
Family alpha-catenin/vinculin 0.078
Further Details:      
 
Domain Number 6 Region: 1769-1895
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000439
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 692-823
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000942
Family I/LWEQ domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1029-1144
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000000111
Family VBS domain 0.014
Further Details:      
 
Domain Number 9 Region: 605-721
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000288
Family I/LWEQ domain 0.0028
Further Details:      
 
Domain Number 10 Region: 1622-1720
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000018
Family VBS domain 0.067
Further Details:      
 
Domain Number 11 Region: 82-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000204
Family Ubiquitin-related 0.053
Further Details:      
 
Domain Number 12 Region: 1935-2050
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000251
Family VBS domain 0.055
Further Details:      
 
Domain Number 13 Region: 470-571
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000298
Family I/LWEQ domain 0.0097
Further Details:      
 
Weak hits

Sequence:  jgi|Dicpu1|148964|GID1.0039653
Domain Number - Region: 1186-1293
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000345
Family VBS domain 0.026
Further Details:      
 
Domain Number - Region: 1428-1486,1531-1594
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000589
Family I/LWEQ domain 0.019
Further Details:      
 
Domain Number - Region: 799-931
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00212
Family alpha-catenin/vinculin 0.026
Further Details:      
 
Domain Number - Region: 10-51
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0103
Family Ubiquitin-related 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|148964|GID1.0039653
Sequence length 2595
Sequence
MSLTLKIQIVRDKQVKAMKFSPTQTVAEVCAQVREKINETSGDDHGLFQPGIEGKRPSRW
LKMEKTLQFYDLKINDELDYKKKHRPLKVRLMDETVKTLLVDDSLTVAEILEIIGKRIGI
KNYEEFSLQNETKEGEWLTHSQPLHEQGVSDDAILLLKKKFFVDDFNVNRDDPIQLHLVY
VQSRDAIVSGSHPCSYDEAIQFAALQCQVQLGNHNPNLHKPGYLKIKEYLPPSFHKKKEA
EKDIYKEFRKLTGMSESNSKFRYVQLCRSLKTYGITFFQTKERVKGQKKPVPKLLGITRD
SILRLDAETKEVEHEYPLNHLRRWAASPQSFTLDFGDYEDDYVSVMTTEGEAISQLLSGY
IEILMKKRKDTGTVIEENENDIANVESVGRIRGQVSQATTSSSLSGFDGSGGREGQYSSP
GQAMGYRGGLGGPLSVKVTNVDSASAAVANLLNEMQLDPNSVIGQKSALTPAQWRQQLAI
HAKAVAAAAGKLLGNLNNPNGLDKSQMDSNARDVALTIDQLVHAARAASIASGEDPDGEM
PLFDGAKAVAESISKLLKATKDLSANPEDENARNLIQQAADQLKLMTAYLDGACNGVITD
PGTLKLLLEAGKAIAIATQDLVNQSQIAIANVNDPIRKQQLNMAIEETSKAGIHASAVAQ
ALAATILDPNCRQQFNTAAKTAQDTNTYLLSAAKAAQLDAATLEKLRNAAKNITDAFGNL
LQSADLAQPKSADDLEFTNAAKTILSAAAQLLGSQGKSDNIIASSKLIEEAMGQLIAGAR
RAALKAEDPAVRDRLIQCSKAVAEAVRNLTEVAQESADNPEDKVLFAKLQEASKRVATAV
KQLVGDAGKESAFQALRTNAKLACAATQGLMNSCRQAMLQNHVPDQEANKLLLSIINANA
PINNLLNAITNSQKNPNDMNAQNQLIDVARASAPLAYQVVATAKGSVPHVTDSNSKSEVS
NSSNIAADAIKALLDSLGDLTSAVGQQDFDDALDQVQALEADMESSALQVQSGLIQQIPG
QTRENALELLNVAARALGSSAKQVLLQYKKEPEKLGETSKNLASSVSQVTNAAKSVCFTT
QNRSVQKAVLGAAKQITTESTNLVSCARAVTSNPGDSSLESALQSSVKAIAEALANLLTT
SKGGEPGGKELDDAIEAIKNDTKRINNPPVNLGGEGGTNSEKAISSCKALIGAVSQVAAN
ARSNPSALGTSAKTTSSTFTILVDSLNVCTGTIQNKTLAIEVVKGGQLLGLESIKLLQAS
RFAASRPGEGENELNQSQQAISNIAKTLIYNIQSSVPGQAEIADAIEMVKQAILSLNSSE
SSGSRPHALEGLSQAARSLADSTSQVVQSKGNSEKMGTQCKNASEALKDVVEYTKASLTS
AEGHPDSIKTLAGKVDYASTSLAESCKKSGPLSDQEKKNAAIDAKSLALSVPNLMNAAKK
ISAGLVQTNPEKSKDILLISQNITNATSKMVNTAKLVASGQEPNNVEQLGSIKKEVTELI
NKLLNATEGYDPHSTSIAIDLDSLDKSEQALLDASRSTANYMSQFMAISKNISSGTKDPN
VHQQFSGAAQNVSAGVQSLLAAINGMKPEQKDLDESIEVIQNAVVDLDSATLAAAIGLLE
NTAPAGKTAQACQEELVEISRELASSMKTFLAAPKADPSNLGKSAKDTANILPKIVNISK
QLASLTTNPEIKQTQLLLSKKLADNMLELMISAKSGDVCDSKQAFNASQSIADILTSVRG
GVMQSRDCDESIQIINKSKENLQKPANQQTGKTYQQYRDEMTEIAKSLALGVSQLANSAK
SKPEEIGSSSLKIASIIPRLAETARSTAAATNDTAAKQKLIDSTMGIIDATSNIIGDAKL
ASADHKNNQLQQKISNNFKDITTQIANLISALKAGATGDRDIETALNEVNHVTTDLDAAS
LFAAAGQIDVDIEGHSAQDIQTEIAKLSQELKNANHQLVDSTNKTIEDVAFSSKAIASVN
QKLSHASKVCAALTSDSATQQNLLSSARAVSSNLQQTISASKTTQKNPSDANKTILNKAS
KDLDDSIESLSSLVQSSTTTKGISELENISSEIRRQLATYDTPNATANASATAEDVANSA
KNLAESIAYLVSSCNSNPEEINEASKATVAAVKGLLANSKGSTRLTDDAVIQQNVTESAK
AAANTILKLVQAAKQQRNDPTNTQAQNKLSEVSSEVVESINNVVSAAEDLPGGERAKKLF
AAGENLEEMAEKELKAAAAIIEEATASLLRAKKKREENRLASGVDEAGIDEAILEAARAI
TSATGILVQCATAVQHELVMAGKVGNKTGNVYRRDPTWARGLISAAQSVAGSVQGLVVSA
NNTTQGKVEEETLIASARGVAAATARLVTASRAKADLNSQSNSQLAQAAKSVSNATTHLV
EAAKSVNSKDEDNEPVFDPSGMSFTGLKVHEMEQQVKILKLKKELEKAEKQLFTIRKSEY
SDSSPAKQETAPPPARPQPATPKPQPSPSTTSISVGTSPIKRPMPQPPSPNMTSANSPSA
PPRPAIKKPAGQSSAPKKVYTYEELKTKPANIDHNNLENYLSDEEFTKIFNMNRDEFGAL
PAWKRSNLKSKLSLF
Download sequence
Identical sequences F0ZCG3
jgi|Dicpu1|148964|GID1.0039653 XP_003285122.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]