SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|45674|estExt_Genewise1.C_300023 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|45674|estExt_Genewise1.C_300023
Domain Number 1 Region: 766-942
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.66e-62
Family Polyphosphate kinase C-terminal domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 375-574
Classification Level Classification E-value
Superfamily PHP14-like 2.16e-57
Family PPK middle domain-like 0.00046
Further Details:      
 
Domain Number 3 Region: 588-760
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.66e-42
Family Polyphosphate kinase C-terminal domain 0.000075
Further Details:      
 
Domain Number 4 Region: 273-373
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 2.49e-20
Family PPK N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|45674|estExt_Genewise1.C_300023
Sequence length 952
Sequence
MELHRYKISQECPVDFEDDYDEESSSFYEEDEDSSAQENPANLIPNPNDKKIKPRIGNKK
KKESTTTSTTNNEFPSKESIDKLKSKGPIQNPLVKSQVLQESNNQSGLFSPTEFVKSSTV
SQAKSPAPIKLSSMLGLSSLGTSNLLSVQNPQPIEGTQGTLNNWDAPPLHTVLPDPSYCQ
DTIDDEDNFIVPTSKYSFLDINNLFSSNYFMGSNNCLTTPTNSDTNSHFIKNSGKINDPT
SSTGTVTPPFSNNEPISESEIPLDVKVMQLSGSRLFFNRELSELIYFYRILYEAYNTTYP
ILERVRFIAITSQNLDMYFCKRALKLRLGYISTRKTLKPEERYINLVLNTTRNLINEMYN
LYCNILQPELANNNVFIIKYNELTEPEKVQLRAFFLQHVFPLMTPLVVDAGHPFPNLSNL
SLNIAALLKHDEDTTRFVRIKVPQRIPRFVHIKQRSPYSIIPMEEIILANLDTIFPNTEI
VSKSLFRVTRHNDLKLNNEDQANDLLELIKTELHKRRFAPMVRLEVSQNMPPEILDMLKT
QLALDEYDVYSINGPLGITDLFELCKLNLPHLKFQPWVPHIPQKLVNLARYPSEDIFSVI
RKGEFLVNLPYLSFNSSVQFFIESAVKDPKVLAIKIAIYRTNSNSQLIRALCEAASHKEV
MALIDLKASGDEEQNTKFARLLEQAGCHVSYGLVGLKTHSKIAMVVREEENGLREYLHIS
TGNYNASTADVYADIGLFSCDPELGEDMCNLFNYLTGYSRITSFKKLVIAPMNMRSTLIQ
LIDNEAKNAREGKEATINAVMNGLDDKRIVNALYQASIAGVKITLVVRGRCRILPGIKQI
SENIRVISVLGRFLEHSRIYCFHNNGKPKAYIASADWLHRNLKRRVEVLVPVEDPNNIKQ
LYDIIKVYVNDTNAWDMLPDGRYKKRSVPIDEDSQSYFMRQTNQQHPVIWTK
Download sequence
Identical sequences F0ZBC5
XP_003284741.1.95606 jgi|Dicpu1|45674|estExt_Genewise1.C_300023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]