SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|96603|estExt_fgeneshDP_pg.C_200039 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|96603|estExt_fgeneshDP_pg.C_200039
Domain Number 1 Region: 573-723,750-827
Classification Level Classification E-value
Superfamily Hsp33 domain 1.31e-35
Family Hsp33 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 113-305
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.91e-20
Family Nuclease 0.047
Further Details:      
 
Domain Number 3 Region: 821-876
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00000000123
Family HSP33 redox switch-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|96603|estExt_fgeneshDP_pg.C_200039
Sequence length 918
Sequence
MSFTSFFITLFNMIKRVLPRLSPFVQPQRLFAALMIIRGSSQVVNNNNSNNNNNNNNNVS
NSPPSTPLLSTTNNNKTRQTLKSINNLNIPKKSTLDSRTISNYSREFTTSNKQKIYDDAY
LNDLFWQLSSQGPGFLIDANNVEFIQEPIDFYNHLIDGVKRSKKRITLASLYLGTGSQEI
KLVEEMTKAMEREKDLKIHILLDGLRGTRMGLDKQSSATLLGDLMNKYPDRVNISMYHTP
DLNGILKKVLPPRVNETIGVQHLKTYVFDDDLLLSGANLSKDYFTNRQDRYVLIRSTEAV
SSYFYEIVETIGTLSMTVDKETFTQLLPKPGMTINPITESKEFKELAYKKLSTLLKPHQF
YSGDNGKKSIDSPFDLINNNNTNNDTWIFPTIQMGPFNIRQDEVVTSHIFSSVPKESKFF
ITSPYFNLTDNYLNLILLGKPKLDIITCSPQANGFYGSKGLSSAVPDCYAMIEKAFLQKV
RDSNNENRINVQEYIRDKWTYHAKGLWITDTKDQSMNYLKNAFISNNQSILILNNTLKQT
VSLNIRTRNYTQNSSNEKSAKVEEYKRTRDQVLTAHNEKFRFSIINLTKTANTAQTKHKL
TTSDTQLLGKVMSGVSMCASFLSDEERISAQLISDINPTHIYAQAIQVGEVRGFLINGDT
PRLEMPNEEIKRNGVFQFSKVLYGHLKPIQSYVEIKDKDLTITKEFQHYFDQSEQIPTYI
KLESFAYPNKETQKSQQLELDQGSTMATETPSDTNSIEFNGGLIIQTLPSTPNSELERLK
EAIESNRSIADLFLSEKKSLKEILSTITNNEPFEVIGTTFIDFYCRCTLKSFKDRLLSLG
KDEIKHLEKHNHNELKCIYCNKFLYLTEKDFKEMLEVLDKQETEIENNNNTESTTNVENN
NNNNNNNNNNNNNENKKE
Download sequence
Identical sequences F0Z9V6
XP_003284184.1.95606 jgi|Dicpu1|96603|estExt_fgeneshDP_pg.C_200039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]