SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|97622|estExt_fgeneshDP_pg.C_910014 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dicpu1|97622|estExt_fgeneshDP_pg.C_910014
Domain Number - Region: 40-107
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.00209
Family L,D-transpeptidase catalytic domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|97622|estExt_fgeneshDP_pg.C_910014
Sequence length 134
Sequence
MDQEWTYEQSTGKLYDSSNKHVATGYSGNGTHINKADSQGVKSKGPLPRGTYTMNEPRKS
DKTGAYAMDLTPSPENNMEGRDSFQIHGDNSKGDKSASEGCIILSRDIREKMWTSNIHKL
KVVDKVSQAKSAEQ
Download sequence
Identical sequences F0ZIC9
jgi|Dicpu1|97622|estExt_fgeneshDP_pg.C_910014 XP_003287163.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]