SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|146888|GID1.0037577 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|146888|GID1.0037577
Domain Number 1 Region: 47-363
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-98
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|146888|GID1.0037577
Sequence length 377
Sequence
MLSNFLKVNSRTIGPIRTFATKNGEVKITFKKADSYLCDGPANTTTTNKEELMNYFTEMT
RMRKLETVADGLYKKKLIRGFCHLYNGQEAVCAGLEYSVTKEDHIITAYRDHTYMLSRGA
TPEEIFAELLMKETGCSKGKGGSMHMFTRNFYGGNGIVGAQCPVGTGIAFAQKYNKTGNV
CLTLYGDGAANQGQLFEAFNMAELWKLPVIFVCENNHYGMGTSQKRAAAGHDFYTRAHYI
PGLKVDGMDIFAVREAGKYAADWARAGKGPMVLEMDTYRYVGHSMSDPGITYRTREEINS
VRQNRDPIENLRNIILANKFATEDELTTIEDTVKQEMDVAADKAIAAPFPQAKELYTNVY
IQEVPIRGVELSNSFKP
Download sequence
Identical sequences F0Z755
XP_003283249.1.95606 jgi|Dicpu1|146888|GID1.0037577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]