SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|149337|GID1.0040026 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|149337|GID1.0040026
Domain Number 1 Region: 304-1002
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-165
Family Motor proteins 0.0000000512
Further Details:      
 
Domain Number 2 Region: 2862-2980
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000615
Family Second domain of FERM 0.0037
Further Details:      
 
Domain Number 3 Region: 1756-1828
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000586
Family Ras-binding domain, RBD 0.037
Further Details:      
 
Domain Number 4 Region: 1866-1950
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000366
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number 5 Region: 2048-2121
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000497
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 
Domain Number 6 Region: 2386-2427
Classification Level Classification E-value
Superfamily SH3-domain 0.00000706
Family SH3-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  jgi|Dicpu1|149337|GID1.0040026
Domain Number - Region: 2768-2840
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000344
Family UBX domain 0.067
Further Details:      
 
Domain Number - Region: 2982-3071
Classification Level Classification E-value
Superfamily PH domain-like 0.00172
Family Third domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|149337|GID1.0040026
Sequence length 3123
Sequence
MYNPWVDNPKERTDLRVDRERSHSHSHHSSKSSPQNHGKSSSHQNGGNKDNKDRDNKDNY
SPSASSYEPTSFLLPPASLSSTSPPLSPIHQTVVNSSVGSFSQISSSTAPTSNSLTIPNL
SSSSSSSSSSNNNNNSTSSTKLSPHSNKNSSISLNISNNNNNTPDDYKKEKKKNKKKNKQ
NGVNSNSNNTNSSNNSTGSIGSNNIININNSNNNIPVLSSTSSSPNSSTNSLSNNINCNN
NNTNNTNSSTNHHIVPLLNLPGSSSNQSTGQLSSCERGQSSSRVYAQSPSSSSNINQLTT
LLEKNKVGFDDLSEIKDLDEDSILNCLQSRYKKDLIYTFIGPILVTINPYKRLPYLHSQE
LLRVYNQKRGLPPHLFAIAERAVCDMQDFKRDQLIFLAGETGSGKSESTKVLIQYFLTTD
LSRNKYLKDYIIEAGIILESFGHCLTDSNNNSSRWGRYFELYYNHYGEIKGAKLYSCERN
YHVFYQLFRGISDEERQSYHLGDLNSYHYLNQGGNISDNLEDAKKYDRLKTAFDFFEFPS
EKVDLIFRIISFITILGNVNFFQKSGKIEFKDKSLIESLSHNIKIDVNKLDSILILDRYM
SVSDAMEHRDSLAKSIYSALFHWIIDFLNTKLKPDSTEELHFIGILDLFGQEGVPLHSYE
QFSINFLEDKLQQIYLNTVLKDEQKEYISERIPWAQPITFKENYDQVEMMEKIISLLDQE
SKNINSNDTIFLDKLNNFLTGHRQYFRKPSKFGIEHFFGTFYYDVKGFIVKNRDEILQRN
TILIKNVITKLLFYKDGQFNSNFSPEIANLMNDPRHHSKKSPLSIIKTIPALNQCGLHFI
RCIRPNYKNSPLTFDSKLVNEQIKTLSLLETCKIQRFGFTTHYEIKLFFERFSFFFRGQR
PNFQILFDKLKENDINFESILHPPLHLGNNKVFLRNTLGTLLESELQKRRVHSAFVIQST
WRMYQTRKKFLEMKSAIIVIQRQSKKYLSQKSYHSIKQATIILESFSRMVICRAPYLRLK
ESAIALQTHLRSSLSKDYTQKLIEKQNNPLIPTPVLPLSLEINISPSPTPPISPLPYYPI
LKASNNTNTINNEQQQQQNNHQQPLPPLHHPPHHTTSKRHIKNSLSSQQHQQQQLSSSQE
SEKTKNIRVPPLQISGTSLNLSSLNNNINNNSNSNSSTPNRPKDVISPIISPSVSDQQPH
HQPLQHPSTTTHHSPITSPPISPRLESPRKGKEKDPSLSTPTTSHGKHVFSLNLDKASPF
NFIAESAKSIKSTITGSNTSKLIPSPRFNSENNNNNNNNIPSNSKNDKYLSLSIPGLLIS
PTSPSISNSLSTNNSISGHGFPSISSINNTSPGFQQPTSSSSSFSSQHRYSLNLDRRKST
NQLLYSNQKEHIKEKEKEKEREKEREKEREKEKEREKEREKEKEKEKEREKEREKEREKE
REREREKEKEREKEREKEREREEINRSVPLSPRSPRTTIGSYPSFIGHTPTSLFTPSGSS
KAGALIGPPSFFTQKEGTTPILPIYLPSYFSFLKKESNPVLTTPRRRSKSFLIKPNDTEE
FSMLEYAKLHFELKSKKSLIRKKQISYESLISYGKKLYYPLHKLDVEPSLQNNPSHLAHL
EKISLEVFNFILQFMGDLERKKSINYIGSHIVRQGILYPEIRDEIYCQIIKQLTNYPGKR
ENRIKGWELLLTVCGCFAPKPRLLKYISSYLYSHHNNSNEDDDLSLVCFNRLEVIIQNGP
RSMPPIDTEFEATRRRMPLKVFFLFPDDVGEGVEVDSTTTCGDITDRLVKVAGLKSDAFI
WSVYEVIKNKERSVSYSEYVLDIVSKWENYYQSVNHYNTLSPHESLHMDAFQFYFKIQLF
VKPEVVPNEFESGFFFHQIIMAITKGHFPVTESEVVILSVLRLQYDITTNNHPKSALEMW
QRYIPQNYLSLYSAKDWSDRIQSKFFELHPYFSFIQTKCKDIFEYKEDVKQVIISYVMSL
PFFGKTVFLNCTQGQWSEIETGAMEGFSVIVDANGAHIVLKESIPGQLISTNQGTQITSI
SIDKTINPQTLQLQLQQYQQQYQQYQQQLQQLHALQQQIQQQQQQYQQFQQQQQQQQLPP
LQLQNDTYISMMNMMNVNMNMGMINLNLNTTPRDDKKENSNVLDDNSVNNKLNVDSKTII
SQPDNNSSNNININSNNSNNINNSNNSNINNSNIINIRKSEGNERTNRLTVIINENNSIP
AENNNVILMSDPSLNSNNINSNNNINNINNNMNNSINNINNQNIISSGLVSPKSMPFGSF
SSPTKRGVGSQVNLPLISSDDFDSDYEQIGKPKDTFKPLKSFHYSKVLSCESDPENQQVN
INIDGEDLVINTPQWTEVILLINSYIYYLSSEATSGTANRDYASPNGAFEFKVKDTITNI
IRGSEGWCTGTFNGLSGSFPLEYVNLIIEKREHKPITSDKKAKEKTNSNSNNTNNTINNN
NIVNARKTSQSVHPSQQLFVQQRLQLEQQLIQQQNQLQNLLQQQIQHQLKQQQLQQQQIQ
QQQQQQQQLQLQQQQQQLQQQQQQLQQQQQQQQPSHRGSVSRPQRKPKEKKKTSVSKGFE
PEFFTKFVESGSKHPLMPYAVNRFRSLTVFKLGDALRHTGTPPEQSSVFITDVNTEDYDI
FLNIMKYMGDYPLFPRDRKTRLLQTIIQRAIDKPSLRDEVYFFLCRQLTPNNQTQAPIPN
SARKGMVLFSLCAGCFPCSAELFPYLREFLTQTQNIFSASCIKKLESTSLKGPRTNAPSK
KEILAVKEHRNIVIRVHLANGPVRTVEVNSSTTALESLKTIVDIQDFVLWREFAIFKDWS
GEEISLKDNEKLCDILKEFEDKEKRQRKTDQTVINGRFVLLRKIWIPHISQTMSNTMLEL
MFYQYVHDVLGGRIPGLTIDVSLELAALQLQAQEGDYNAQQPIISEDTVELCIPATLLDR
KGLSQWVIEINEAHSDLADQAITPELALSMYLQKASSLPYAGSTWFCIDTRRRNPNNNSQ
NNTNTTIWIGINQNFMVFFNHAMENEIERFDLDEVSGFTYREDSFSFLIGDLINPTRKLF
FTTQGEDINEIYQTFKSLPKIDLVEIERRNERKKERKEKEKRKALKQQQLLQQQEEQDDQ
DDY
Download sequence
Identical sequences F0ZDF7
jgi|Dicpu1|149337|GID1.0040026 XP_003285437.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]